Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AVX9

Protein Details
Accession A0A2T4AVX9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-51EYTSAETPRKKKHQRSEPIPSSPHydrophilic
NLS Segment(s)
PositionSequence
39-40KK
66-71NKLRGR
Subcellular Location(s) mito 19.5, mito_nucl 13.833, nucl 7
Family & Domain DBs
Amino Acid Sequences MAPLSRKKKSVIVLAALSRHGTVSCKGGEYTSAETPRKKKHQRSEPIPSSPPLLPVPVPVHSKERNKLRGRRQQTPPEAEREKKETNDLLTPFSPGPDRQNGPSPACSRVTRNGPLQTRKRHLPPFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.4
4 0.35
5 0.26
6 0.21
7 0.16
8 0.14
9 0.13
10 0.15
11 0.15
12 0.15
13 0.16
14 0.15
15 0.16
16 0.17
17 0.2
18 0.22
19 0.28
20 0.29
21 0.34
22 0.4
23 0.48
24 0.55
25 0.61
26 0.65
27 0.7
28 0.77
29 0.83
30 0.85
31 0.87
32 0.84
33 0.79
34 0.72
35 0.62
36 0.54
37 0.44
38 0.38
39 0.27
40 0.21
41 0.15
42 0.16
43 0.17
44 0.17
45 0.19
46 0.18
47 0.23
48 0.27
49 0.32
50 0.35
51 0.42
52 0.47
53 0.54
54 0.6
55 0.65
56 0.69
57 0.72
58 0.75
59 0.75
60 0.76
61 0.75
62 0.74
63 0.66
64 0.64
65 0.63
66 0.56
67 0.52
68 0.49
69 0.45
70 0.39
71 0.4
72 0.35
73 0.32
74 0.35
75 0.32
76 0.29
77 0.26
78 0.27
79 0.23
80 0.22
81 0.21
82 0.17
83 0.21
84 0.24
85 0.26
86 0.27
87 0.36
88 0.39
89 0.41
90 0.46
91 0.43
92 0.4
93 0.42
94 0.41
95 0.37
96 0.41
97 0.44
98 0.43
99 0.48
100 0.53
101 0.57
102 0.65
103 0.7
104 0.72
105 0.72
106 0.75
107 0.77