Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AJW6

Protein Details
Accession A0A2T4AJW6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPPKPRAGQIRKPAPRRRKPNTINLQLAHydrophilic
NLS Segment(s)
PositionSequence
4-20KPRAGQIRKPAPRRRKP
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 5.5, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPPKPRAGQIRKPAPRRRKPNTINLQLAVGQSMDYTATAVNPGATSAMGLPFLAPMPSSAPAPISDAPIAREYVDLYTILPPTSSHRYEPSLALYTSLGPFLISLSSSVFLLLLHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.89
4 0.87
5 0.88
6 0.85
7 0.86
8 0.86
9 0.84
10 0.79
11 0.69
12 0.62
13 0.52
14 0.45
15 0.34
16 0.23
17 0.14
18 0.09
19 0.08
20 0.06
21 0.04
22 0.05
23 0.04
24 0.04
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.05
33 0.04
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.1
50 0.1
51 0.11
52 0.11
53 0.11
54 0.13
55 0.13
56 0.13
57 0.1
58 0.1
59 0.09
60 0.09
61 0.09
62 0.08
63 0.07
64 0.09
65 0.09
66 0.09
67 0.08
68 0.08
69 0.13
70 0.2
71 0.21
72 0.21
73 0.24
74 0.28
75 0.3
76 0.31
77 0.3
78 0.27
79 0.25
80 0.24
81 0.22
82 0.2
83 0.18
84 0.17
85 0.12
86 0.08
87 0.08
88 0.07
89 0.08
90 0.06
91 0.06
92 0.08
93 0.09
94 0.09
95 0.09
96 0.08