Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AI97

Protein Details
Accession A0A2T4AI97    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-95AAQLIRSTHYKRKRKMETRIVIWKHAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, E.R. 3, vacu 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009653  Ksh1  
Gene Ontology GO:0000139  C:Golgi membrane  
Pfam View protein in Pfam  
PF06842  DUF1242  
Amino Acid Sequences MSALFNFKSLLLVILLLICTSTYVHHFTPGIMDRNKNGVMGIFWKCARIGERLSPYISICCVIMAVRVHAAQLIRSTHYKRKRKMETRIVIWKHAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.04
6 0.05
7 0.05
8 0.06
9 0.08
10 0.12
11 0.12
12 0.15
13 0.15
14 0.14
15 0.19
16 0.22
17 0.26
18 0.25
19 0.26
20 0.25
21 0.29
22 0.29
23 0.24
24 0.2
25 0.14
26 0.12
27 0.15
28 0.16
29 0.14
30 0.14
31 0.14
32 0.14
33 0.15
34 0.16
35 0.15
36 0.15
37 0.18
38 0.22
39 0.23
40 0.23
41 0.23
42 0.22
43 0.19
44 0.17
45 0.12
46 0.09
47 0.07
48 0.06
49 0.06
50 0.08
51 0.08
52 0.09
53 0.1
54 0.1
55 0.1
56 0.11
57 0.12
58 0.1
59 0.12
60 0.13
61 0.15
62 0.2
63 0.26
64 0.34
65 0.44
66 0.53
67 0.58
68 0.67
69 0.76
70 0.8
71 0.86
72 0.88
73 0.87
74 0.86
75 0.88
76 0.81