Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4AKM0

Protein Details
Accession A0A2T4AKM0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
78-106LGPGARRRRSTMRQLKRQVRRFRDARESVHydrophilic
NLS Segment(s)
PositionSequence
83-95RRRRSTMRQLKRQ
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences RTSSIRESASASEDDREGDDGDIVDRDVLRGLHIVASAACDEEVDAFVRNRTGLRLRRFLADLKVLETLRDIQPVEGLGPGARRRRSTMRQLKRQVRRFRDARESVMAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.14
5 0.12
6 0.12
7 0.1
8 0.1
9 0.1
10 0.09
11 0.08
12 0.07
13 0.07
14 0.08
15 0.07
16 0.07
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.06
23 0.08
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.06
31 0.05
32 0.06
33 0.06
34 0.07
35 0.07
36 0.08
37 0.08
38 0.09
39 0.16
40 0.22
41 0.26
42 0.31
43 0.32
44 0.33
45 0.35
46 0.34
47 0.3
48 0.27
49 0.23
50 0.19
51 0.22
52 0.2
53 0.18
54 0.17
55 0.17
56 0.14
57 0.16
58 0.15
59 0.11
60 0.12
61 0.12
62 0.12
63 0.09
64 0.08
65 0.07
66 0.1
67 0.16
68 0.22
69 0.25
70 0.27
71 0.32
72 0.41
73 0.48
74 0.56
75 0.62
76 0.66
77 0.73
78 0.82
79 0.86
80 0.88
81 0.9
82 0.9
83 0.87
84 0.87
85 0.83
86 0.81
87 0.81
88 0.75
89 0.71