Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4A1S0

Protein Details
Accession A0A2T4A1S0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
29-55EKATRIDKRQFQRRQERKREGNPQKIVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 13.833, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLYYQGLNSDVKDELSRDEKPDTLDKLAEKATRIDKRQFQRRQERKREGNPQKIVLKYLYSGNNANQGKKRDLAIYNDGKPGPMDLSTIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.22
4 0.23
5 0.24
6 0.24
7 0.27
8 0.31
9 0.31
10 0.28
11 0.28
12 0.26
13 0.26
14 0.28
15 0.26
16 0.22
17 0.22
18 0.29
19 0.33
20 0.36
21 0.4
22 0.44
23 0.51
24 0.61
25 0.65
26 0.66
27 0.71
28 0.77
29 0.82
30 0.85
31 0.86
32 0.83
33 0.84
34 0.85
35 0.84
36 0.83
37 0.76
38 0.71
39 0.66
40 0.59
41 0.52
42 0.42
43 0.33
44 0.24
45 0.25
46 0.23
47 0.2
48 0.21
49 0.21
50 0.29
51 0.29
52 0.33
53 0.33
54 0.35
55 0.35
56 0.36
57 0.36
58 0.33
59 0.35
60 0.37
61 0.4
62 0.43
63 0.43
64 0.46
65 0.44
66 0.38
67 0.35
68 0.3
69 0.24
70 0.17
71 0.15