Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZRD1

Protein Details
Accession A0A2T3ZRD1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28RKREKGKVIKLTKPKPFNKDLRKMDKFFBasic
NLS Segment(s)
PositionSequence
2-16KREKGKVIKLTKPKP
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences RKREKGKVIKLTKPKPFNKDLRKMDKFFLEFLTYFRYFPYTLKDDEDRVIFAGSCLAGDAEIWFRLIIQNYEEGKINLKKLKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.78
4 0.79
5 0.79
6 0.8
7 0.8
8 0.81
9 0.8
10 0.76
11 0.7
12 0.66
13 0.57
14 0.47
15 0.4
16 0.32
17 0.25
18 0.23
19 0.27
20 0.21
21 0.19
22 0.18
23 0.18
24 0.15
25 0.16
26 0.2
27 0.16
28 0.16
29 0.19
30 0.21
31 0.2
32 0.2
33 0.2
34 0.15
35 0.13
36 0.13
37 0.1
38 0.08
39 0.08
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.06
49 0.07
50 0.06
51 0.07
52 0.1
53 0.12
54 0.12
55 0.12
56 0.19
57 0.2
58 0.22
59 0.24
60 0.22
61 0.27
62 0.3
63 0.35