Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4ABD0

Protein Details
Accession A0A2T4ABD0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-87VSAGKRRTEKARPGRFRTPMSHydrophilic
NLS Segment(s)
PositionSequence
57-82HRAEKGGMKNVSAGKRRTEKARPGRF
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSIVPCLIQATRKTSPTDNLTFGLLVPAGSVGVQEESKRADDFGSASDSVAKEMNRHRAEKGGMKNVSAGKRRTEKARPGRFRTPMSPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.44
4 0.44
5 0.39
6 0.36
7 0.34
8 0.3
9 0.26
10 0.21
11 0.14
12 0.09
13 0.07
14 0.06
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.05
21 0.05
22 0.06
23 0.08
24 0.09
25 0.1
26 0.09
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.09
33 0.09
34 0.1
35 0.1
36 0.1
37 0.12
38 0.11
39 0.12
40 0.16
41 0.26
42 0.27
43 0.29
44 0.29
45 0.32
46 0.35
47 0.39
48 0.42
49 0.41
50 0.38
51 0.37
52 0.4
53 0.42
54 0.45
55 0.44
56 0.4
57 0.38
58 0.45
59 0.49
60 0.53
61 0.56
62 0.6
63 0.65
64 0.74
65 0.76
66 0.77
67 0.83
68 0.82
69 0.79
70 0.75