Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4AHI1

Protein Details
Accession A0A2T4AHI1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MNRRKRKSRRAEEKSAQVICHydrophilic
NLS Segment(s)
PositionSequence
3-11RRKRKSRRA
Subcellular Location(s) mito 20.5, cyto_mito 12, nucl 4
Family & Domain DBs
Amino Acid Sequences MNRRKRKSRRAEEKSAQVICGATAALLHNLAPIGWVQVSKGTAWPITSAAERPGKRRSTYKKSTYELAKACNMEAFSYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.75
3 0.63
4 0.53
5 0.43
6 0.32
7 0.25
8 0.15
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.04
20 0.04
21 0.05
22 0.05
23 0.04
24 0.06
25 0.07
26 0.07
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.08
33 0.09
34 0.1
35 0.1
36 0.14
37 0.21
38 0.22
39 0.25
40 0.32
41 0.35
42 0.38
43 0.47
44 0.52
45 0.55
46 0.64
47 0.69
48 0.7
49 0.69
50 0.73
51 0.7
52 0.68
53 0.62
54 0.56
55 0.53
56 0.45
57 0.42
58 0.38
59 0.32