Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4APF4

Protein Details
Accession A0A2T4APF4    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
63-88LERLAWPKQRPKPKPQTGRRIERDPFHydrophilic
NLS Segment(s)
PositionSequence
70-81KQRPKPKPQTGR
Subcellular Location(s) mito 21, nucl 2.5, cyto_nucl 2.5, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGIARRCPPAQASSCCRCVEHPRFFPWTANESPLLLCLGLDILLLHSQNNPPRSEKASSLTSLERLAWPKQRPKPKPQTGRRIERDPFIVGPRHRAYKYYTYTAGGALYFGLLVEYFAPLLSQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.5
4 0.46
5 0.49
6 0.51
7 0.53
8 0.52
9 0.52
10 0.57
11 0.57
12 0.57
13 0.51
14 0.47
15 0.38
16 0.36
17 0.31
18 0.26
19 0.24
20 0.21
21 0.17
22 0.11
23 0.09
24 0.06
25 0.06
26 0.05
27 0.04
28 0.04
29 0.04
30 0.05
31 0.06
32 0.06
33 0.07
34 0.11
35 0.15
36 0.18
37 0.19
38 0.2
39 0.23
40 0.27
41 0.28
42 0.27
43 0.26
44 0.26
45 0.25
46 0.25
47 0.23
48 0.19
49 0.17
50 0.16
51 0.14
52 0.14
53 0.17
54 0.21
55 0.26
56 0.34
57 0.41
58 0.51
59 0.55
60 0.63
61 0.71
62 0.74
63 0.8
64 0.81
65 0.85
66 0.83
67 0.88
68 0.84
69 0.8
70 0.72
71 0.64
72 0.58
73 0.49
74 0.42
75 0.35
76 0.35
77 0.28
78 0.34
79 0.35
80 0.38
81 0.36
82 0.36
83 0.39
84 0.41
85 0.46
86 0.44
87 0.42
88 0.38
89 0.38
90 0.36
91 0.31
92 0.21
93 0.16
94 0.1
95 0.08
96 0.06
97 0.05
98 0.05
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05