Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZT89

Protein Details
Accession A0A2T3ZT89    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-31RPRPITITRRVLKPKPKPKPPASWALLHydrophilic
NLS Segment(s)
PositionSequence
10-25TITRRVLKPKPKPKPP
Subcellular Location(s) mito 13.5, mito_nucl 12.166, nucl 9.5, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MTMRRPRPITITRRVLKPKPKPKPPASWALLGASKLGRASPFRAPCFPLRCIPPSHYIYLPPSLPICPSSLLHSLLHSLHPQSIYWNQHPLLFRILKNTPLLLHNPRNVWPSRGSWPHRPCCHGTEPDSQHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.77
4 0.8
5 0.81
6 0.81
7 0.86
8 0.87
9 0.86
10 0.88
11 0.82
12 0.82
13 0.74
14 0.67
15 0.58
16 0.51
17 0.44
18 0.34
19 0.3
20 0.2
21 0.17
22 0.13
23 0.12
24 0.11
25 0.12
26 0.15
27 0.22
28 0.28
29 0.3
30 0.32
31 0.35
32 0.39
33 0.42
34 0.41
35 0.37
36 0.35
37 0.35
38 0.35
39 0.35
40 0.36
41 0.34
42 0.34
43 0.3
44 0.28
45 0.27
46 0.26
47 0.23
48 0.17
49 0.15
50 0.13
51 0.13
52 0.12
53 0.1
54 0.09
55 0.1
56 0.12
57 0.14
58 0.16
59 0.15
60 0.15
61 0.15
62 0.15
63 0.16
64 0.13
65 0.11
66 0.11
67 0.11
68 0.11
69 0.13
70 0.18
71 0.22
72 0.23
73 0.27
74 0.26
75 0.29
76 0.3
77 0.29
78 0.29
79 0.28
80 0.26
81 0.28
82 0.29
83 0.28
84 0.28
85 0.28
86 0.22
87 0.22
88 0.27
89 0.29
90 0.34
91 0.35
92 0.36
93 0.39
94 0.42
95 0.41
96 0.39
97 0.34
98 0.32
99 0.37
100 0.44
101 0.47
102 0.53
103 0.61
104 0.68
105 0.71
106 0.72
107 0.68
108 0.65
109 0.67
110 0.63
111 0.59
112 0.59