Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4ADA9

Protein Details
Accession A0A2T4ADA9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKVKQKKKKQKKKMGVDISGGBasic
NLS Segment(s)
PositionSequence
4-13KQKKKKQKKK
Subcellular Location(s) mito 21.5, cyto_mito 11.833, pero 2, cyto_nucl 1.833
Family & Domain DBs
Amino Acid Sequences MKVKQKKKKQKKKMGVDISGGGVCDIPAIDLHGHQSAVVSNGLFPRSSLVPHVKVAGRHGFGARAGKQSCPASRGSQKQLEAASTFFDLLLLVGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.88
3 0.8
4 0.7
5 0.61
6 0.5
7 0.39
8 0.28
9 0.18
10 0.12
11 0.08
12 0.06
13 0.04
14 0.04
15 0.05
16 0.06
17 0.06
18 0.08
19 0.09
20 0.09
21 0.08
22 0.09
23 0.07
24 0.08
25 0.09
26 0.06
27 0.06
28 0.08
29 0.09
30 0.08
31 0.08
32 0.08
33 0.08
34 0.09
35 0.11
36 0.14
37 0.15
38 0.16
39 0.19
40 0.18
41 0.18
42 0.22
43 0.24
44 0.21
45 0.2
46 0.2
47 0.18
48 0.18
49 0.23
50 0.21
51 0.23
52 0.23
53 0.23
54 0.27
55 0.31
56 0.31
57 0.28
58 0.29
59 0.29
60 0.37
61 0.43
62 0.46
63 0.48
64 0.47
65 0.49
66 0.47
67 0.43
68 0.36
69 0.29
70 0.24
71 0.19
72 0.18
73 0.13
74 0.12
75 0.09