Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4ARS3

Protein Details
Accession A0A2T4ARS3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MGRGGKREKKRKWKMNSKSRKRYSRWQLLSKLRBasic
NLS Segment(s)
PositionSequence
3-23RGGKREKKRKWKMNSKSRKRY
Subcellular Location(s) mito 10.5, cyto_mito 7, plas 4, E.R. 4, nucl 3, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGRGGKREKKRKWKMNSKSRKRYSRWQLLSKLRLMSFKTEGRSRWCCRSRNEERGTAESCELVRSGANGDSDPGLDMRSCKCFFFLLLLLFLLLFYFLISSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.94
4 0.94
5 0.94
6 0.94
7 0.93
8 0.88
9 0.88
10 0.87
11 0.87
12 0.84
13 0.81
14 0.8
15 0.79
16 0.78
17 0.7
18 0.63
19 0.54
20 0.49
21 0.42
22 0.37
23 0.33
24 0.31
25 0.32
26 0.31
27 0.32
28 0.35
29 0.41
30 0.41
31 0.46
32 0.49
33 0.5
34 0.51
35 0.59
36 0.61
37 0.63
38 0.63
39 0.59
40 0.55
41 0.54
42 0.52
43 0.43
44 0.34
45 0.25
46 0.21
47 0.16
48 0.13
49 0.09
50 0.07
51 0.06
52 0.08
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.08
61 0.07
62 0.07
63 0.09
64 0.1
65 0.17
66 0.18
67 0.18
68 0.19
69 0.19
70 0.19
71 0.22
72 0.23
73 0.18
74 0.18
75 0.17
76 0.16
77 0.15
78 0.14
79 0.1
80 0.07
81 0.05
82 0.04