Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZYD8

Protein Details
Accession A0A2T3ZYD8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-42EEKPPKAPLAIPRRKRNRIRTSCRPCRARKSKCDGNRPSCLHydrophilic
NLS Segment(s)
PositionSequence
6-21PKAPLAIPRRKRNRIR
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MEEKPPKAPLAIPRRKRNRIRTSCRPCRARKSKCDGNRPSCLTCLSRGLPDQCVYEQQRPGEHRIVSIRNIPHPSPNNTILSGSPVAASNRDSLYHRSLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.88
4 0.89
5 0.89
6 0.9
7 0.9
8 0.9
9 0.91
10 0.92
11 0.91
12 0.89
13 0.85
14 0.86
15 0.87
16 0.85
17 0.84
18 0.82
19 0.83
20 0.83
21 0.86
22 0.84
23 0.8
24 0.79
25 0.73
26 0.65
27 0.56
28 0.5
29 0.41
30 0.33
31 0.3
32 0.22
33 0.2
34 0.2
35 0.2
36 0.2
37 0.19
38 0.19
39 0.15
40 0.2
41 0.22
42 0.24
43 0.25
44 0.24
45 0.28
46 0.29
47 0.33
48 0.33
49 0.29
50 0.27
51 0.29
52 0.31
53 0.28
54 0.32
55 0.29
56 0.3
57 0.34
58 0.33
59 0.36
60 0.39
61 0.42
62 0.42
63 0.44
64 0.41
65 0.37
66 0.38
67 0.3
68 0.29
69 0.24
70 0.19
71 0.15
72 0.15
73 0.15
74 0.16
75 0.17
76 0.15
77 0.16
78 0.18
79 0.2
80 0.23