Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4ADC8

Protein Details
Accession A0A2T4ADC8    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
239-260SEESEKKEKKSNDKVVKKDLAEHydrophilic
NLS Segment(s)
PositionSequence
231-256AKKRKATSSEESEKKEKKSNDKVVKK
265-273LRRSKRLRK
Subcellular Location(s) nucl 20, cyto_nucl 12.833, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSSSVVPHSEITKEQFASCLSQYPSLIEAIPAKNGQKTLSELDQYRYVDAVDTFNLKKPKREMNLDDVKLLVEWKLRHGKFRPTLMSLVSSNPPSASQTIQFAIKFYSSSKDIGSGVRLLSELKGVGPATASLLLSVHDPERVIFFSDEAFYWLCCEGKKAPIKYNPKEYLALRTEAEALAKRLGVSAMDIEKVAYVLMKKQETTKDAKAVTAVKPKVPVKESASTSSSAKKRKATSSEESEKKEKKSNDKVVKKDLAEDDSSLRRSKRLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.27
4 0.27
5 0.28
6 0.26
7 0.27
8 0.24
9 0.25
10 0.26
11 0.25
12 0.25
13 0.22
14 0.21
15 0.16
16 0.19
17 0.17
18 0.2
19 0.21
20 0.21
21 0.23
22 0.24
23 0.23
24 0.21
25 0.23
26 0.25
27 0.27
28 0.3
29 0.29
30 0.32
31 0.36
32 0.34
33 0.31
34 0.27
35 0.22
36 0.19
37 0.18
38 0.16
39 0.12
40 0.15
41 0.16
42 0.21
43 0.29
44 0.29
45 0.34
46 0.38
47 0.46
48 0.49
49 0.56
50 0.56
51 0.58
52 0.67
53 0.62
54 0.57
55 0.47
56 0.4
57 0.32
58 0.27
59 0.18
60 0.12
61 0.12
62 0.18
63 0.28
64 0.28
65 0.35
66 0.39
67 0.47
68 0.49
69 0.55
70 0.53
71 0.46
72 0.47
73 0.41
74 0.4
75 0.31
76 0.27
77 0.23
78 0.2
79 0.17
80 0.15
81 0.15
82 0.13
83 0.14
84 0.12
85 0.11
86 0.13
87 0.14
88 0.16
89 0.15
90 0.14
91 0.13
92 0.12
93 0.12
94 0.1
95 0.12
96 0.12
97 0.13
98 0.12
99 0.13
100 0.13
101 0.14
102 0.14
103 0.12
104 0.1
105 0.1
106 0.1
107 0.08
108 0.08
109 0.08
110 0.06
111 0.05
112 0.06
113 0.06
114 0.06
115 0.06
116 0.05
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.05
126 0.05
127 0.05
128 0.06
129 0.07
130 0.07
131 0.09
132 0.08
133 0.08
134 0.08
135 0.09
136 0.08
137 0.09
138 0.08
139 0.06
140 0.07
141 0.08
142 0.08
143 0.07
144 0.1
145 0.1
146 0.17
147 0.24
148 0.27
149 0.33
150 0.42
151 0.51
152 0.54
153 0.62
154 0.59
155 0.55
156 0.55
157 0.49
158 0.48
159 0.41
160 0.38
161 0.28
162 0.25
163 0.23
164 0.19
165 0.2
166 0.14
167 0.12
168 0.11
169 0.11
170 0.1
171 0.1
172 0.1
173 0.08
174 0.07
175 0.08
176 0.09
177 0.09
178 0.09
179 0.08
180 0.08
181 0.08
182 0.07
183 0.06
184 0.06
185 0.09
186 0.15
187 0.16
188 0.17
189 0.21
190 0.27
191 0.29
192 0.36
193 0.37
194 0.38
195 0.37
196 0.37
197 0.36
198 0.35
199 0.37
200 0.39
201 0.36
202 0.32
203 0.39
204 0.42
205 0.45
206 0.43
207 0.43
208 0.39
209 0.45
210 0.47
211 0.44
212 0.44
213 0.39
214 0.39
215 0.41
216 0.42
217 0.42
218 0.44
219 0.46
220 0.5
221 0.57
222 0.63
223 0.62
224 0.64
225 0.67
226 0.71
227 0.71
228 0.71
229 0.72
230 0.7
231 0.67
232 0.67
233 0.65
234 0.65
235 0.69
236 0.74
237 0.76
238 0.8
239 0.82
240 0.83
241 0.83
242 0.74
243 0.7
244 0.64
245 0.58
246 0.51
247 0.45
248 0.41
249 0.39
250 0.41
251 0.38
252 0.34
253 0.36