Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZZ87

Protein Details
Accession A0A2T3ZZ87    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
89-108GERRLIRRSRHRPAAKQGWGBasic
NLS Segment(s)
PositionSequence
96-99RSRH
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFVCCRSRHDEKADRIRGGGFHNESLRRQVSYQQRESPTVQGSSRGKDKQVMSNTTRRFLMAWGYFLQCSCFGSLVTPLSPLRFDIDGGERRLIRRSRHRPAAKQGWGLFLKTGFWMVIGRTSLCRCAGKPCIEQSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.62
3 0.56
4 0.49
5 0.43
6 0.41
7 0.33
8 0.3
9 0.34
10 0.36
11 0.36
12 0.39
13 0.37
14 0.3
15 0.29
16 0.33
17 0.38
18 0.44
19 0.48
20 0.5
21 0.52
22 0.54
23 0.55
24 0.51
25 0.44
26 0.38
27 0.32
28 0.31
29 0.3
30 0.3
31 0.35
32 0.32
33 0.3
34 0.33
35 0.35
36 0.36
37 0.4
38 0.42
39 0.4
40 0.47
41 0.47
42 0.43
43 0.41
44 0.33
45 0.27
46 0.22
47 0.24
48 0.16
49 0.17
50 0.16
51 0.17
52 0.17
53 0.16
54 0.16
55 0.1
56 0.1
57 0.08
58 0.07
59 0.06
60 0.07
61 0.08
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.1
73 0.16
74 0.19
75 0.21
76 0.24
77 0.22
78 0.23
79 0.3
80 0.32
81 0.34
82 0.41
83 0.49
84 0.56
85 0.66
86 0.73
87 0.73
88 0.79
89 0.82
90 0.77
91 0.74
92 0.65
93 0.62
94 0.55
95 0.49
96 0.39
97 0.29
98 0.24
99 0.18
100 0.17
101 0.1
102 0.09
103 0.1
104 0.09
105 0.13
106 0.14
107 0.15
108 0.18
109 0.2
110 0.22
111 0.25
112 0.28
113 0.25
114 0.31
115 0.38
116 0.41
117 0.45