Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4A510

Protein Details
Accession A0A2T4A510    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
334-355DAPAAKKAKKAAKESKPKAESNHydrophilic
NLS Segment(s)
PositionSequence
178-201RPIPVVLKPKARKVDGKKTKPQKK
308-323KKLKAAEKANIGKKRK
337-379AAKKAKKAAKESKPKAESNDDKLDKQISDRKLRLRSAKAAAKK
Subcellular Location(s) cyto 12.5, cyto_nucl 12.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MAPSKEVAAAGSKAVVSIDSAQTLKASKALLAHIKKASKEQTEASSKRNILEDDVDAEKTVWLTLTTKRHISDKARLQPGKIPLPHSLNASAETTVCLITADPQRAYKNIVASDEFPAELRKKVTRVIDVTKLKAKFSQYEAQRKLFAEHDVFLGDDRIINRLPKILGKTFYKSTLKRPIPVVLKPKARKVDGKKTKPQKKEGEVNAGSAAEIAKEIEKALSSALVSLSPTTNTAVRVGFSDWTPEQLAANIETVAAAMVDKWVPQQWRNVKSIYIKGPETAALPIWLTDELWLDDKDVIADAEGEAKKLKAAEKANIGKKRKTTDDSAEQQADAPAAKKAKKAAKESKPKAESNDDKLDKQISDRKLRLRSAKAAAKKAVEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.09
4 0.12
5 0.13
6 0.15
7 0.15
8 0.15
9 0.17
10 0.18
11 0.16
12 0.15
13 0.15
14 0.13
15 0.16
16 0.21
17 0.29
18 0.32
19 0.37
20 0.41
21 0.45
22 0.45
23 0.5
24 0.53
25 0.48
26 0.48
27 0.46
28 0.48
29 0.54
30 0.55
31 0.51
32 0.52
33 0.48
34 0.46
35 0.46
36 0.39
37 0.32
38 0.32
39 0.3
40 0.25
41 0.26
42 0.24
43 0.2
44 0.2
45 0.17
46 0.14
47 0.12
48 0.09
49 0.08
50 0.1
51 0.16
52 0.23
53 0.27
54 0.3
55 0.32
56 0.36
57 0.42
58 0.47
59 0.49
60 0.52
61 0.58
62 0.64
63 0.64
64 0.62
65 0.61
66 0.61
67 0.6
68 0.53
69 0.47
70 0.43
71 0.47
72 0.47
73 0.44
74 0.39
75 0.31
76 0.3
77 0.27
78 0.22
79 0.17
80 0.15
81 0.13
82 0.1
83 0.09
84 0.07
85 0.06
86 0.11
87 0.16
88 0.18
89 0.19
90 0.22
91 0.24
92 0.24
93 0.29
94 0.25
95 0.25
96 0.24
97 0.25
98 0.23
99 0.24
100 0.25
101 0.22
102 0.19
103 0.15
104 0.17
105 0.17
106 0.17
107 0.19
108 0.19
109 0.2
110 0.25
111 0.28
112 0.3
113 0.34
114 0.36
115 0.43
116 0.43
117 0.45
118 0.46
119 0.43
120 0.39
121 0.37
122 0.35
123 0.29
124 0.31
125 0.35
126 0.36
127 0.46
128 0.49
129 0.48
130 0.48
131 0.45
132 0.42
133 0.36
134 0.32
135 0.23
136 0.19
137 0.17
138 0.15
139 0.14
140 0.12
141 0.11
142 0.08
143 0.07
144 0.07
145 0.09
146 0.09
147 0.1
148 0.1
149 0.12
150 0.12
151 0.14
152 0.18
153 0.19
154 0.22
155 0.25
156 0.28
157 0.28
158 0.33
159 0.36
160 0.34
161 0.38
162 0.45
163 0.44
164 0.43
165 0.43
166 0.44
167 0.42
168 0.46
169 0.46
170 0.42
171 0.49
172 0.48
173 0.52
174 0.5
175 0.49
176 0.51
177 0.52
178 0.56
179 0.58
180 0.64
181 0.67
182 0.73
183 0.8
184 0.78
185 0.79
186 0.76
187 0.73
188 0.74
189 0.69
190 0.68
191 0.59
192 0.53
193 0.45
194 0.36
195 0.29
196 0.2
197 0.16
198 0.05
199 0.05
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.06
215 0.06
216 0.06
217 0.07
218 0.08
219 0.09
220 0.09
221 0.1
222 0.1
223 0.1
224 0.11
225 0.11
226 0.11
227 0.1
228 0.14
229 0.12
230 0.14
231 0.14
232 0.13
233 0.12
234 0.13
235 0.13
236 0.1
237 0.11
238 0.08
239 0.07
240 0.07
241 0.07
242 0.05
243 0.04
244 0.03
245 0.03
246 0.04
247 0.04
248 0.04
249 0.06
250 0.09
251 0.12
252 0.14
253 0.24
254 0.32
255 0.37
256 0.4
257 0.4
258 0.4
259 0.43
260 0.47
261 0.44
262 0.4
263 0.35
264 0.33
265 0.33
266 0.3
267 0.26
268 0.2
269 0.14
270 0.11
271 0.1
272 0.09
273 0.1
274 0.09
275 0.08
276 0.08
277 0.09
278 0.09
279 0.11
280 0.11
281 0.11
282 0.11
283 0.11
284 0.11
285 0.1
286 0.09
287 0.06
288 0.07
289 0.05
290 0.13
291 0.13
292 0.13
293 0.13
294 0.13
295 0.14
296 0.16
297 0.19
298 0.19
299 0.24
300 0.29
301 0.38
302 0.47
303 0.55
304 0.62
305 0.65
306 0.63
307 0.65
308 0.67
309 0.65
310 0.61
311 0.59
312 0.59
313 0.63
314 0.63
315 0.64
316 0.59
317 0.51
318 0.46
319 0.4
320 0.32
321 0.23
322 0.18
323 0.16
324 0.2
325 0.22
326 0.25
327 0.32
328 0.39
329 0.46
330 0.56
331 0.62
332 0.66
333 0.75
334 0.81
335 0.84
336 0.82
337 0.78
338 0.74
339 0.74
340 0.71
341 0.68
342 0.7
343 0.63
344 0.58
345 0.57
346 0.55
347 0.45
348 0.44
349 0.45
350 0.42
351 0.49
352 0.54
353 0.59
354 0.64
355 0.71
356 0.73
357 0.72
358 0.72
359 0.72
360 0.74
361 0.74
362 0.74
363 0.71