Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AG95

Protein Details
Accession A0A2T4AG95    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-56ESFTNRGNKLKKRARFAHKGQLMPHydrophilic
NLS Segment(s)
PositionSequence
42-47LKKRAR
Subcellular Location(s) nucl 11, cyto 9.5, cyto_mito 8.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039602  Rxt2  
IPR013904  RXT2_N  
Gene Ontology GO:0016575  P:histone deacetylation  
Pfam View protein in Pfam  
PF08595  RXT2_N  
Amino Acid Sequences MASQQVLFAETIAGMKKAFKRRAYESDSDSEIESFTNRGNKLKKRARFAHKGQLMPSAGPGAYKETVEYAGVRRSIIHRNPPLVDEDGYEFDSDDDESRVEEAILSAAELNPYANIRLERTFAVQPVWAGLALTLTDILAPLTASTDLPTHPVLSKPFTSNTLTELVKQSSGIMQKENRSLWQVRHLWTSLCGDSTWVPCSTMVGTNDIEFYTQDNEAHQPTDPSKAGDNTSSPSKVNGEKKPDGSAAHAASTNEPGEQGTAAPADADVPMGDAESPGKRKTPPKEPEAMETDDGASKEQPNEAEDAKKDNGKNILNGDPGRNTNGREPSAENTSQGRKKGSRLPSEDVQMQDSVEPTNKASQENSEAKKDAKTSYIHPMFLPPTNASLDRNLGLPDNEAEDIRRLLALYVQKQEEVCRGAARLHLGLLRAQRLRKDVLGWSKAEAHCGPNRDMSDGEDWYDKEEWGLTEDLKKGQDEEEEDTATAGKKTRNRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.16
3 0.24
4 0.34
5 0.42
6 0.46
7 0.52
8 0.6
9 0.69
10 0.72
11 0.7
12 0.66
13 0.63
14 0.59
15 0.53
16 0.46
17 0.36
18 0.28
19 0.22
20 0.17
21 0.13
22 0.14
23 0.2
24 0.2
25 0.28
26 0.37
27 0.45
28 0.55
29 0.64
30 0.68
31 0.71
32 0.8
33 0.82
34 0.84
35 0.83
36 0.83
37 0.8
38 0.76
39 0.68
40 0.66
41 0.57
42 0.47
43 0.4
44 0.32
45 0.24
46 0.21
47 0.2
48 0.17
49 0.16
50 0.16
51 0.15
52 0.14
53 0.15
54 0.16
55 0.17
56 0.15
57 0.19
58 0.19
59 0.19
60 0.2
61 0.23
62 0.32
63 0.37
64 0.44
65 0.45
66 0.49
67 0.5
68 0.5
69 0.49
70 0.42
71 0.36
72 0.28
73 0.25
74 0.22
75 0.21
76 0.2
77 0.16
78 0.13
79 0.13
80 0.12
81 0.1
82 0.09
83 0.08
84 0.09
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.07
100 0.08
101 0.1
102 0.11
103 0.13
104 0.15
105 0.16
106 0.17
107 0.2
108 0.21
109 0.19
110 0.2
111 0.18
112 0.16
113 0.15
114 0.15
115 0.1
116 0.08
117 0.07
118 0.06
119 0.06
120 0.06
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.03
129 0.04
130 0.05
131 0.05
132 0.06
133 0.07
134 0.07
135 0.1
136 0.1
137 0.11
138 0.11
139 0.14
140 0.16
141 0.18
142 0.21
143 0.21
144 0.22
145 0.24
146 0.26
147 0.23
148 0.23
149 0.24
150 0.22
151 0.22
152 0.23
153 0.21
154 0.18
155 0.18
156 0.16
157 0.16
158 0.19
159 0.18
160 0.19
161 0.22
162 0.25
163 0.3
164 0.3
165 0.27
166 0.28
167 0.3
168 0.28
169 0.33
170 0.34
171 0.31
172 0.34
173 0.33
174 0.29
175 0.28
176 0.3
177 0.21
178 0.18
179 0.15
180 0.13
181 0.14
182 0.16
183 0.15
184 0.12
185 0.13
186 0.12
187 0.13
188 0.13
189 0.15
190 0.14
191 0.14
192 0.14
193 0.14
194 0.14
195 0.13
196 0.12
197 0.08
198 0.09
199 0.08
200 0.08
201 0.08
202 0.09
203 0.11
204 0.11
205 0.12
206 0.11
207 0.11
208 0.11
209 0.16
210 0.15
211 0.14
212 0.15
213 0.16
214 0.17
215 0.17
216 0.17
217 0.14
218 0.17
219 0.17
220 0.15
221 0.15
222 0.16
223 0.21
224 0.28
225 0.31
226 0.35
227 0.37
228 0.38
229 0.4
230 0.39
231 0.33
232 0.28
233 0.27
234 0.2
235 0.17
236 0.17
237 0.15
238 0.14
239 0.15
240 0.13
241 0.09
242 0.08
243 0.07
244 0.06
245 0.06
246 0.06
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.03
256 0.04
257 0.04
258 0.04
259 0.04
260 0.03
261 0.05
262 0.07
263 0.1
264 0.1
265 0.12
266 0.16
267 0.24
268 0.3
269 0.4
270 0.43
271 0.47
272 0.54
273 0.54
274 0.54
275 0.52
276 0.48
277 0.38
278 0.32
279 0.27
280 0.21
281 0.2
282 0.16
283 0.12
284 0.1
285 0.11
286 0.11
287 0.11
288 0.1
289 0.13
290 0.13
291 0.15
292 0.15
293 0.19
294 0.19
295 0.23
296 0.23
297 0.24
298 0.29
299 0.28
300 0.29
301 0.28
302 0.3
303 0.29
304 0.3
305 0.28
306 0.25
307 0.24
308 0.26
309 0.24
310 0.22
311 0.25
312 0.29
313 0.28
314 0.28
315 0.29
316 0.28
317 0.33
318 0.31
319 0.27
320 0.25
321 0.32
322 0.34
323 0.34
324 0.36
325 0.33
326 0.37
327 0.44
328 0.49
329 0.5
330 0.53
331 0.56
332 0.54
333 0.56
334 0.55
335 0.47
336 0.4
337 0.31
338 0.25
339 0.2
340 0.17
341 0.14
342 0.12
343 0.12
344 0.11
345 0.16
346 0.17
347 0.18
348 0.19
349 0.2
350 0.26
351 0.34
352 0.36
353 0.35
354 0.35
355 0.35
356 0.37
357 0.37
358 0.31
359 0.27
360 0.26
361 0.26
362 0.35
363 0.37
364 0.35
365 0.33
366 0.35
367 0.34
368 0.34
369 0.33
370 0.23
371 0.22
372 0.24
373 0.25
374 0.22
375 0.22
376 0.21
377 0.19
378 0.19
379 0.17
380 0.16
381 0.15
382 0.15
383 0.14
384 0.14
385 0.14
386 0.13
387 0.14
388 0.14
389 0.14
390 0.13
391 0.12
392 0.1
393 0.09
394 0.14
395 0.19
396 0.22
397 0.27
398 0.28
399 0.29
400 0.3
401 0.32
402 0.32
403 0.28
404 0.25
405 0.2
406 0.2
407 0.21
408 0.23
409 0.24
410 0.19
411 0.18
412 0.19
413 0.18
414 0.21
415 0.24
416 0.28
417 0.3
418 0.32
419 0.34
420 0.37
421 0.4
422 0.38
423 0.37
424 0.38
425 0.43
426 0.45
427 0.42
428 0.41
429 0.45
430 0.43
431 0.45
432 0.39
433 0.35
434 0.35
435 0.38
436 0.38
437 0.37
438 0.38
439 0.35
440 0.33
441 0.31
442 0.31
443 0.28
444 0.28
445 0.24
446 0.23
447 0.25
448 0.25
449 0.22
450 0.18
451 0.18
452 0.17
453 0.16
454 0.18
455 0.16
456 0.2
457 0.23
458 0.26
459 0.26
460 0.26
461 0.25
462 0.25
463 0.28
464 0.27
465 0.3
466 0.3
467 0.29
468 0.29
469 0.27
470 0.27
471 0.23
472 0.21
473 0.2
474 0.22