Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T3ZWW0

Protein Details
Accession A0A2T3ZWW0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-93EHQRRGSFSSKSRKKQKPVASHydrophilic
NLS Segment(s)
PositionSequence
83-89KSRKKQK
Subcellular Location(s) extr 18, mito 7
Family & Domain DBs
Amino Acid Sequences MLKESIKSAYFRNRLPVGACTGAWLCGLIGSAYGFWIQNRNTPALESSFVYAGSGISRNRGLRAAVGCELSAEHQRRGSFSSKSRKKQKPVAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.39
4 0.34
5 0.31
6 0.28
7 0.23
8 0.21
9 0.2
10 0.17
11 0.15
12 0.09
13 0.07
14 0.08
15 0.05
16 0.05
17 0.05
18 0.04
19 0.05
20 0.05
21 0.05
22 0.05
23 0.1
24 0.1
25 0.14
26 0.16
27 0.17
28 0.17
29 0.17
30 0.18
31 0.15
32 0.15
33 0.12
34 0.11
35 0.09
36 0.09
37 0.08
38 0.07
39 0.06
40 0.06
41 0.08
42 0.07
43 0.09
44 0.12
45 0.13
46 0.14
47 0.15
48 0.15
49 0.16
50 0.17
51 0.19
52 0.18
53 0.18
54 0.16
55 0.15
56 0.15
57 0.14
58 0.2
59 0.2
60 0.2
61 0.23
62 0.24
63 0.26
64 0.29
65 0.32
66 0.31
67 0.37
68 0.46
69 0.53
70 0.63
71 0.72
72 0.78
73 0.82