Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AAS2

Protein Details
Accession A0A2T4AAS2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
99-124EDKARVLEKTKKRNTHFPQRKFAIKVHydrophilic
NLS Segment(s)
PositionSequence
86-119PKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRK
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKAAQLWGKNKEELAKQLSELKAELGQLRIQKVASSGSKLNKIHDLRKSIARVLTVTNATQRNQLRLFYKKSKYLPLDLRPKQTRAIRRRLSPEDKARVLEKTKKRNTHFPQRKFAIKVRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.47
4 0.45
5 0.43
6 0.38
7 0.33
8 0.31
9 0.36
10 0.35
11 0.31
12 0.27
13 0.23
14 0.19
15 0.19
16 0.19
17 0.14
18 0.16
19 0.17
20 0.18
21 0.18
22 0.17
23 0.16
24 0.15
25 0.18
26 0.17
27 0.18
28 0.21
29 0.23
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.4
36 0.41
37 0.42
38 0.38
39 0.43
40 0.43
41 0.37
42 0.35
43 0.29
44 0.25
45 0.21
46 0.21
47 0.16
48 0.15
49 0.17
50 0.17
51 0.17
52 0.22
53 0.22
54 0.23
55 0.23
56 0.26
57 0.25
58 0.29
59 0.35
60 0.38
61 0.41
62 0.43
63 0.45
64 0.51
65 0.49
66 0.51
67 0.52
68 0.53
69 0.59
70 0.57
71 0.64
72 0.59
73 0.58
74 0.58
75 0.57
76 0.59
77 0.57
78 0.63
79 0.6
80 0.63
81 0.7
82 0.73
83 0.73
84 0.72
85 0.73
86 0.71
87 0.66
88 0.62
89 0.56
90 0.52
91 0.51
92 0.52
93 0.52
94 0.55
95 0.62
96 0.69
97 0.73
98 0.79
99 0.81
100 0.83
101 0.84
102 0.82
103 0.82
104 0.8
105 0.81
106 0.76
107 0.76