Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4APD5

Protein Details
Accession A0A2T4APD5    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVLHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 11, cyto 10, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVLLDKTISEKLYKDVQSYRLVTVAVLVDRMKINGSLARQCIRDLEEKGMIKPVITHSKMKIYTRAIGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.5
14 0.4
15 0.34
16 0.27
17 0.19
18 0.18
19 0.16
20 0.15
21 0.1
22 0.11
23 0.12
24 0.18
25 0.19
26 0.2
27 0.22
28 0.25
29 0.28
30 0.29
31 0.27
32 0.21
33 0.2
34 0.17
35 0.15
36 0.12
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.08
43 0.07
44 0.07
45 0.08
46 0.09
47 0.12
48 0.15
49 0.18
50 0.2
51 0.2
52 0.21
53 0.21
54 0.22
55 0.25
56 0.24
57 0.25
58 0.29
59 0.3
60 0.3
61 0.34
62 0.3
63 0.25
64 0.25
65 0.27
66 0.3
67 0.32
68 0.36
69 0.34
70 0.43
71 0.48
72 0.49
73 0.5
74 0.45