Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AUS8

Protein Details
Accession A0A2T4AUS8    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MMRCRGGISLRKKKRQNDRVRENDDEGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 13.166, mito_nucl 12.999, mito 4
Family & Domain DBs
Amino Acid Sequences MMRCRGGISLRKKKRQNDRVRENDDEGETGKGNERKKNTVLTREKRAWVGKDWCCGMCNNWTRAHTPVLVSLRSSSSLCADMLSTAQSAGFVLLLRQRPYSSNPRFRGSSGHYIPLFGGRSDSSLIPSISRNDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.88
4 0.88
5 0.89
6 0.89
7 0.88
8 0.84
9 0.77
10 0.7
11 0.59
12 0.49
13 0.4
14 0.31
15 0.24
16 0.19
17 0.21
18 0.22
19 0.25
20 0.3
21 0.34
22 0.37
23 0.39
24 0.48
25 0.47
26 0.53
27 0.59
28 0.6
29 0.64
30 0.63
31 0.63
32 0.58
33 0.57
34 0.49
35 0.46
36 0.48
37 0.43
38 0.42
39 0.42
40 0.37
41 0.34
42 0.31
43 0.26
44 0.25
45 0.27
46 0.26
47 0.27
48 0.28
49 0.29
50 0.3
51 0.3
52 0.23
53 0.18
54 0.2
55 0.19
56 0.17
57 0.16
58 0.15
59 0.14
60 0.15
61 0.14
62 0.1
63 0.09
64 0.1
65 0.1
66 0.09
67 0.08
68 0.07
69 0.07
70 0.08
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.05
80 0.09
81 0.13
82 0.15
83 0.16
84 0.17
85 0.19
86 0.25
87 0.35
88 0.4
89 0.47
90 0.5
91 0.54
92 0.55
93 0.53
94 0.54
95 0.5
96 0.51
97 0.44
98 0.46
99 0.41
100 0.4
101 0.4
102 0.38
103 0.32
104 0.22
105 0.21
106 0.15
107 0.17
108 0.18
109 0.18
110 0.16
111 0.18
112 0.19
113 0.18
114 0.2