Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4AHX8

Protein Details
Accession A0A2T4AHX8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-52VGVRVRRCSEKRDKVRSRRARKCARGVGRWBasic
NLS Segment(s)
PositionSequence
31-52SEKRDKVRSRRARKCARGVGRW
67-110KGRRREEMGRCERGREREKTGIEIGGKVRERALEGEPRRKSGGE
Subcellular Location(s) mito 11, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MRLPDSFFCVWCWQGFGGVERRVGVRVRRCSEKRDKVRSRRARKCARGVGRWGLGEKFVGGRECEEKGRRREEMGRCERGREREKTGIEIGGKVRERALEGEPRRKSGGEQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.24
5 0.25
6 0.25
7 0.24
8 0.24
9 0.24
10 0.26
11 0.3
12 0.32
13 0.39
14 0.43
15 0.52
16 0.54
17 0.6
18 0.68
19 0.71
20 0.72
21 0.74
22 0.8
23 0.8
24 0.89
25 0.91
26 0.91
27 0.9
28 0.9
29 0.9
30 0.87
31 0.86
32 0.84
33 0.8
34 0.74
35 0.69
36 0.63
37 0.55
38 0.47
39 0.4
40 0.3
41 0.23
42 0.18
43 0.13
44 0.09
45 0.08
46 0.08
47 0.07
48 0.09
49 0.1
50 0.12
51 0.16
52 0.21
53 0.27
54 0.31
55 0.36
56 0.36
57 0.38
58 0.45
59 0.48
60 0.54
61 0.55
62 0.59
63 0.55
64 0.59
65 0.6
66 0.6
67 0.59
68 0.54
69 0.53
70 0.51
71 0.52
72 0.51
73 0.48
74 0.44
75 0.37
76 0.35
77 0.3
78 0.3
79 0.29
80 0.26
81 0.25
82 0.22
83 0.23
84 0.23
85 0.25
86 0.28
87 0.34
88 0.44
89 0.46
90 0.48
91 0.49
92 0.47