Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AL66

Protein Details
Accession A0A2T4AL66    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
91-129GHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAWBasic
NLS Segment(s)
PositionSequence
98-126KRRHGWLKRTRSKTGRRILQRRKLKGRRH
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MNSIIRLARPLLAPRISALSQRTYTCLSPLRPTLTSTFRPNNSFTPSLTAQSPAATSPESAADLVPTAAVSSHPALQGLQLRFGPRNTMNGHTRLVQKRRHGWLKRTRSKTGRRILQRRKLKGRRHVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.28
4 0.29
5 0.28
6 0.27
7 0.28
8 0.28
9 0.3
10 0.28
11 0.27
12 0.28
13 0.31
14 0.27
15 0.29
16 0.33
17 0.34
18 0.32
19 0.33
20 0.33
21 0.34
22 0.36
23 0.38
24 0.41
25 0.4
26 0.41
27 0.42
28 0.41
29 0.41
30 0.38
31 0.31
32 0.3
33 0.28
34 0.27
35 0.24
36 0.22
37 0.17
38 0.16
39 0.15
40 0.1
41 0.1
42 0.09
43 0.08
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.06
50 0.05
51 0.05
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.05
58 0.05
59 0.07
60 0.07
61 0.08
62 0.08
63 0.1
64 0.16
65 0.15
66 0.16
67 0.16
68 0.17
69 0.19
70 0.19
71 0.22
72 0.17
73 0.22
74 0.23
75 0.28
76 0.29
77 0.31
78 0.32
79 0.31
80 0.38
81 0.42
82 0.46
83 0.47
84 0.51
85 0.57
86 0.65
87 0.72
88 0.71
89 0.73
90 0.77
91 0.81
92 0.83
93 0.82
94 0.82
95 0.82
96 0.84
97 0.84
98 0.83
99 0.82
100 0.83
101 0.87
102 0.88
103 0.89
104 0.89
105 0.9
106 0.91
107 0.91
108 0.9
109 0.9