Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AD29

Protein Details
Accession A0A2T4AD29    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-58VLRHHYKVKCKRISNSDCPRLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 5, cyto 4, extr 4, E.R. 4, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MYQKIADAGFCFCFAFPIAVLTECSSKAHRRMKIVDVLRHHYKVKCKRISNSDCPRLRFQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.09
4 0.09
5 0.09
6 0.09
7 0.1
8 0.11
9 0.11
10 0.11
11 0.12
12 0.13
13 0.16
14 0.24
15 0.31
16 0.33
17 0.36
18 0.39
19 0.41
20 0.47
21 0.48
22 0.45
23 0.42
24 0.46
25 0.46
26 0.45
27 0.45
28 0.41
29 0.46
30 0.51
31 0.57
32 0.59
33 0.61
34 0.66
35 0.74
36 0.79
37 0.8
38 0.81
39 0.81
40 0.77
41 0.76
42 0.74