Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AJL7

Protein Details
Accession A0A2T4AJL7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-81VFNLSRERNKQKKMLKPKVYRSYSIHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, E.R. 7, golg 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYPPSFAKSFPSLSLMCVSVCVCVFCPAWPLQVGPDAEPELIGRSAVGAFSRPFYIVFNLSRERNKQKKMLKPKVYRSYSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.17
4 0.16
5 0.15
6 0.12
7 0.12
8 0.11
9 0.1
10 0.12
11 0.12
12 0.11
13 0.14
14 0.13
15 0.15
16 0.15
17 0.14
18 0.12
19 0.16
20 0.16
21 0.13
22 0.14
23 0.13
24 0.12
25 0.12
26 0.11
27 0.08
28 0.07
29 0.07
30 0.05
31 0.04
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.08
40 0.09
41 0.1
42 0.12
43 0.14
44 0.15
45 0.19
46 0.22
47 0.26
48 0.3
49 0.36
50 0.44
51 0.5
52 0.54
53 0.59
54 0.64
55 0.71
56 0.78
57 0.82
58 0.82
59 0.84
60 0.89
61 0.9