Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AT16

Protein Details
Accession A0A2T4AT16    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-91AQTTQRHPRTPELNKKKKRRPRKRVBasic
NLS Segment(s)
PositionSequence
78-91ELNKKKKRRPRKRV
Subcellular Location(s) mito 10, plas 8, extr 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKLCWRGMERQGLHVVIGSSVLVPFINCLFYSVSWQRSHGYPCCHTALISHSHSHNHTHTLSHALYAQTTQRHPRTPELNKKKKRRPRKRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.17
4 0.16
5 0.1
6 0.07
7 0.06
8 0.06
9 0.05
10 0.04
11 0.05
12 0.05
13 0.06
14 0.06
15 0.08
16 0.09
17 0.09
18 0.15
19 0.18
20 0.22
21 0.21
22 0.23
23 0.23
24 0.24
25 0.28
26 0.26
27 0.28
28 0.26
29 0.28
30 0.29
31 0.28
32 0.25
33 0.22
34 0.2
35 0.2
36 0.2
37 0.18
38 0.17
39 0.19
40 0.21
41 0.23
42 0.22
43 0.21
44 0.19
45 0.19
46 0.19
47 0.22
48 0.21
49 0.18
50 0.19
51 0.15
52 0.15
53 0.15
54 0.18
55 0.16
56 0.2
57 0.27
58 0.3
59 0.36
60 0.4
61 0.46
62 0.53
63 0.6
64 0.68
65 0.71
66 0.77
67 0.81
68 0.89
69 0.92
70 0.93
71 0.94