Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4ARU2

Protein Details
Accession A0A2T4ARU2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-92VPSSSHRRPNSQARKKPSAKDHydrophilic
NLS Segment(s)
PositionSequence
85-88RKKP
Subcellular Location(s) mito 7plas 7, extr 3, cyto 2, pero 2, E.R. 2, golg 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MLPILLYQSVLWSFFILTPSSFYQQHRIQDETSISQQVVQQLKTLNQSKSNIICKENIRHCWVLTKKLFVHVPSSSHRRPNSQARKKPSAKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.11
4 0.11
5 0.14
6 0.16
7 0.19
8 0.21
9 0.21
10 0.27
11 0.31
12 0.37
13 0.37
14 0.37
15 0.34
16 0.34
17 0.35
18 0.3
19 0.27
20 0.22
21 0.19
22 0.17
23 0.18
24 0.2
25 0.2
26 0.17
27 0.17
28 0.17
29 0.19
30 0.24
31 0.28
32 0.23
33 0.25
34 0.26
35 0.28
36 0.32
37 0.36
38 0.33
39 0.29
40 0.32
41 0.32
42 0.39
43 0.42
44 0.41
45 0.4
46 0.39
47 0.37
48 0.43
49 0.42
50 0.43
51 0.39
52 0.4
53 0.36
54 0.41
55 0.43
56 0.35
57 0.37
58 0.3
59 0.32
60 0.33
61 0.41
62 0.4
63 0.46
64 0.48
65 0.49
66 0.54
67 0.61
68 0.66
69 0.69
70 0.73
71 0.74
72 0.82