Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4A423

Protein Details
Accession A0A2T4A423    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-68DHIAKMCPKKRIRRNKKRNYRLTKQVHSKCTFHydrophilic
NLS Segment(s)
PositionSequence
45-55KKRIRRNKKRN
Subcellular Location(s) nucl 22, cyto_nucl 13.833, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MATEQQPSDDAINQMEGLKITDNPHKGKRCYNCLEPDHIAKMCPKKRIRRNKKRNYRLTKQVHSKCTFTTNYYYNGSGDDGKGTAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.1
5 0.1
6 0.11
7 0.13
8 0.19
9 0.24
10 0.28
11 0.36
12 0.43
13 0.44
14 0.51
15 0.55
16 0.57
17 0.58
18 0.6
19 0.59
20 0.55
21 0.57
22 0.51
23 0.46
24 0.41
25 0.35
26 0.3
27 0.26
28 0.32
29 0.31
30 0.37
31 0.41
32 0.48
33 0.58
34 0.69
35 0.76
36 0.79
37 0.86
38 0.89
39 0.93
40 0.94
41 0.95
42 0.93
43 0.9
44 0.89
45 0.87
46 0.85
47 0.85
48 0.82
49 0.8
50 0.74
51 0.67
52 0.59
53 0.56
54 0.49
55 0.41
56 0.39
57 0.33
58 0.34
59 0.35
60 0.34
61 0.28
62 0.27
63 0.26
64 0.22
65 0.2
66 0.17