Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4AF19

Protein Details
Accession A0A2T4AF19    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
106-129HDHLRVKKTIKKIRRKVQGINGKRBasic
NLS Segment(s)
PositionSequence
111-123VKKTIKKIRRKVQ
Subcellular Location(s) nucl 14, cyto_nucl 9.5, cysk 7, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MPSISDAELSELVELSTKLLQLLDSEHDLSHSEVSSIPTIMLTTPSGQEMDIDTAPSWRDVQLPAHLVNRDKGSGHANGNSDGNGNDGKEKSMTPQPIVRERMTGHDHLRVKKTIKKIRRKVQGINGKRVGEIETRGGNDTEGLSLGQPDASDKTTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.09
4 0.09
5 0.09
6 0.09
7 0.09
8 0.09
9 0.11
10 0.12
11 0.14
12 0.15
13 0.14
14 0.15
15 0.16
16 0.16
17 0.15
18 0.12
19 0.1
20 0.1
21 0.13
22 0.13
23 0.12
24 0.11
25 0.09
26 0.09
27 0.09
28 0.09
29 0.08
30 0.08
31 0.08
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.11
43 0.11
44 0.1
45 0.08
46 0.09
47 0.1
48 0.12
49 0.14
50 0.16
51 0.17
52 0.19
53 0.2
54 0.2
55 0.21
56 0.2
57 0.18
58 0.15
59 0.15
60 0.15
61 0.17
62 0.17
63 0.18
64 0.17
65 0.18
66 0.18
67 0.16
68 0.14
69 0.11
70 0.1
71 0.08
72 0.07
73 0.08
74 0.08
75 0.09
76 0.09
77 0.09
78 0.12
79 0.17
80 0.18
81 0.18
82 0.22
83 0.25
84 0.32
85 0.36
86 0.33
87 0.3
88 0.29
89 0.33
90 0.33
91 0.33
92 0.28
93 0.32
94 0.36
95 0.38
96 0.42
97 0.41
98 0.41
99 0.44
100 0.52
101 0.54
102 0.59
103 0.66
104 0.72
105 0.77
106 0.83
107 0.84
108 0.82
109 0.82
110 0.83
111 0.79
112 0.79
113 0.75
114 0.65
115 0.58
116 0.51
117 0.44
118 0.36
119 0.31
120 0.25
121 0.22
122 0.23
123 0.25
124 0.24
125 0.21
126 0.19
127 0.17
128 0.13
129 0.11
130 0.1
131 0.08
132 0.08
133 0.09
134 0.08
135 0.07
136 0.09
137 0.12