Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZR67

Protein Details
Accession A0A2T3ZR67    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-42KKGYVKKYYRAPKKNSNKKFTPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences PIDLSTIEAQRKNVKCYNCGKKGYVKKYYRAPKKNSNKKFTPVPEPKENQAINTIRPSEDYNILHFLAYYDNNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.54
4 0.61
5 0.6
6 0.6
7 0.57
8 0.61
9 0.68
10 0.69
11 0.7
12 0.64
13 0.61
14 0.67
15 0.74
16 0.75
17 0.73
18 0.72
19 0.72
20 0.79
21 0.84
22 0.83
23 0.81
24 0.74
25 0.7
26 0.7
27 0.64
28 0.63
29 0.61
30 0.58
31 0.59
32 0.58
33 0.56
34 0.56
35 0.52
36 0.43
37 0.42
38 0.37
39 0.31
40 0.33
41 0.32
42 0.24
43 0.26
44 0.27
45 0.23
46 0.28
47 0.27
48 0.25
49 0.27
50 0.27
51 0.25
52 0.22
53 0.19
54 0.17