Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4A1S3

Protein Details
Accession A0A2T4A1S3    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
191-233ENENSHTKKRKGGKRKRIVEEDPWLELKKRRGEKKAKVHDVVLBasic
NLS Segment(s)
PositionSequence
30-52NKRKAALSPGERVTKKRARSSLR
198-227KKRKGGKRKRIVEEDPWLELKKRRGEKKAK
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHKSKKGEFEAEFDLAPTEKARSLPVNKRKAALSPGERVTKKRARSSLRGNDTPRAFKRIMAVAGGEKIRSGLDDGQLDKTTTKATDVTNEKLQIRPGENLGAFASRVDAALPVSGLAKKTSTNAEGKDALGLKVYRTRKERKMHKLYDQWRAEESKIQEKREEELERIAERDLEDDAAGILTSAAFENENSHTKKRKGGKRKRIVEEDPWLELKKRRGEKKAKVHDVVLAPPELHKVELK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.49
3 0.39
4 0.31
5 0.21
6 0.19
7 0.15
8 0.12
9 0.12
10 0.13
11 0.17
12 0.23
13 0.32
14 0.42
15 0.51
16 0.58
17 0.58
18 0.6
19 0.58
20 0.55
21 0.52
22 0.51
23 0.46
24 0.44
25 0.48
26 0.54
27 0.54
28 0.52
29 0.56
30 0.54
31 0.55
32 0.57
33 0.6
34 0.59
35 0.66
36 0.74
37 0.75
38 0.76
39 0.77
40 0.72
41 0.71
42 0.67
43 0.67
44 0.58
45 0.54
46 0.46
47 0.39
48 0.4
49 0.37
50 0.33
51 0.25
52 0.24
53 0.19
54 0.22
55 0.21
56 0.17
57 0.12
58 0.11
59 0.1
60 0.09
61 0.11
62 0.09
63 0.12
64 0.14
65 0.16
66 0.18
67 0.19
68 0.19
69 0.17
70 0.16
71 0.14
72 0.12
73 0.12
74 0.11
75 0.11
76 0.18
77 0.22
78 0.25
79 0.27
80 0.3
81 0.29
82 0.29
83 0.3
84 0.26
85 0.25
86 0.22
87 0.19
88 0.2
89 0.19
90 0.18
91 0.17
92 0.13
93 0.11
94 0.1
95 0.09
96 0.06
97 0.06
98 0.05
99 0.05
100 0.04
101 0.05
102 0.05
103 0.04
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.07
110 0.08
111 0.1
112 0.12
113 0.15
114 0.15
115 0.18
116 0.18
117 0.18
118 0.19
119 0.17
120 0.14
121 0.14
122 0.13
123 0.11
124 0.17
125 0.2
126 0.23
127 0.29
128 0.36
129 0.43
130 0.52
131 0.61
132 0.65
133 0.72
134 0.73
135 0.76
136 0.78
137 0.76
138 0.77
139 0.69
140 0.6
141 0.52
142 0.49
143 0.41
144 0.36
145 0.33
146 0.33
147 0.35
148 0.36
149 0.37
150 0.36
151 0.37
152 0.39
153 0.38
154 0.29
155 0.29
156 0.3
157 0.27
158 0.27
159 0.25
160 0.18
161 0.16
162 0.16
163 0.12
164 0.09
165 0.08
166 0.07
167 0.07
168 0.06
169 0.06
170 0.05
171 0.04
172 0.03
173 0.04
174 0.04
175 0.04
176 0.04
177 0.05
178 0.08
179 0.11
180 0.18
181 0.21
182 0.27
183 0.34
184 0.37
185 0.45
186 0.53
187 0.6
188 0.65
189 0.73
190 0.78
191 0.81
192 0.89
193 0.9
194 0.89
195 0.85
196 0.82
197 0.8
198 0.72
199 0.65
200 0.58
201 0.51
202 0.45
203 0.45
204 0.44
205 0.44
206 0.5
207 0.56
208 0.63
209 0.72
210 0.79
211 0.84
212 0.88
213 0.88
214 0.82
215 0.74
216 0.7
217 0.63
218 0.57
219 0.49
220 0.39
221 0.29
222 0.26
223 0.29
224 0.23