Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4AJ11

Protein Details
Accession A0A2T4AJ11    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-54ANVSHRLSVKKKRRKTCRRTDLVSQRRRHydrophilic
NLS Segment(s)
PositionSequence
36-41KKKRRK
Subcellular Location(s) mito 11, nucl 7, cyto 6, plas 3, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MARLGRQSAERLALWYPIAADLVLFVANVSHRLSVKKKRRKTCRRTDLVSQRRRQSVSVSPPTLLMHLELATPYLLLASAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.14
4 0.11
5 0.11
6 0.08
7 0.07
8 0.05
9 0.06
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.06
16 0.07
17 0.07
18 0.08
19 0.12
20 0.19
21 0.29
22 0.4
23 0.48
24 0.57
25 0.65
26 0.76
27 0.83
28 0.87
29 0.88
30 0.88
31 0.86
32 0.82
33 0.82
34 0.82
35 0.81
36 0.8
37 0.75
38 0.7
39 0.68
40 0.64
41 0.55
42 0.49
43 0.47
44 0.48
45 0.5
46 0.46
47 0.41
48 0.41
49 0.4
50 0.36
51 0.27
52 0.18
53 0.11
54 0.1
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.07
61 0.05