Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4ATS3

Protein Details
Accession A0A2T4ATS3    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-46LIREWEKVGNEKKKKREKKREKKKRKTAAEANEEKKBasic
NLS Segment(s)
PositionSequence
20-60NEKKKKREKKREKKKRKTAAEANEEKKNSRQCKKRLMRERT
66-81GMKGEQPKPPPPGVMK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MNLMIFPWHELIREWEKVGNEKKKKREKKREKKKRKTAAEANEEKKNSRQCKKRLMRERTIEDGGGMKGEQPKPPPPGVMKGKSCRRKATWLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.28
4 0.35
5 0.44
6 0.47
7 0.51
8 0.57
9 0.67
10 0.74
11 0.83
12 0.87
13 0.89
14 0.9
15 0.92
16 0.95
17 0.96
18 0.97
19 0.97
20 0.97
21 0.96
22 0.94
23 0.92
24 0.9
25 0.88
26 0.86
27 0.83
28 0.75
29 0.7
30 0.61
31 0.53
32 0.48
33 0.47
34 0.45
35 0.45
36 0.5
37 0.51
38 0.61
39 0.7
40 0.75
41 0.78
42 0.79
43 0.79
44 0.79
45 0.78
46 0.72
47 0.65
48 0.54
49 0.44
50 0.37
51 0.28
52 0.2
53 0.14
54 0.11
55 0.16
56 0.18
57 0.21
58 0.24
59 0.3
60 0.35
61 0.36
62 0.39
63 0.35
64 0.43
65 0.48
66 0.53
67 0.55
68 0.6
69 0.69
70 0.74
71 0.77
72 0.76
73 0.73