Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4A259

Protein Details
Accession A0A2T4A259    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
158-186GASDIFAREKRKKKKEAREAERRKRRGEKBasic
360-396KSYHHPMPELKEQRRREREERRARRSKSGYRRGNTDEBasic
NLS Segment(s)
PositionSequence
165-188REKRKKKKEAREAERRKRRGEKGK
371-390EQRRREREERRARRSKSGYR
Subcellular Location(s) cyto 10.5, mito 7, cyto_nucl 6.5, extr 3, vacu 3, nucl 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPAVVSAGTGLTGTATVNVIDTDKFPADGPLLQGARVFARLAKRTNDPSKGVLDPHDINNVGFFFLFALIGIAFVATGIWFFFYAKNGGIVFKDNDWDDYKSTVLRRRGPNGTVLSGATESTDLGGGSVYKRYDDHDDDDRRTAITDSTYLTGITAGASDIFAREKRKKKKEAREAERRKRRGEKGKSTEGTAFEGVQDEKAEREAKKLLRSYRHEKAARVGGINKEAEGSEWEGSTNAAESSVGATSELLANQEPTPTSEPPKTSAPPKSTPKSGGIRKVYSTADRRESKEAERERAEARRLRAANRVAQRDFGYQRAAGAVTNSQLSESLLSGSGTGDSTTLGESSIPEEESEVGTKSYHHPMPELKEQRRREREERRARRSKSGYRRGNTDENTDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.06
5 0.07
6 0.08
7 0.09
8 0.09
9 0.1
10 0.14
11 0.14
12 0.15
13 0.15
14 0.16
15 0.17
16 0.18
17 0.19
18 0.22
19 0.22
20 0.22
21 0.22
22 0.21
23 0.21
24 0.2
25 0.18
26 0.14
27 0.22
28 0.27
29 0.31
30 0.35
31 0.4
32 0.48
33 0.57
34 0.59
35 0.54
36 0.52
37 0.52
38 0.5
39 0.45
40 0.39
41 0.37
42 0.33
43 0.32
44 0.34
45 0.3
46 0.28
47 0.28
48 0.24
49 0.19
50 0.15
51 0.13
52 0.08
53 0.08
54 0.08
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.04
61 0.03
62 0.03
63 0.03
64 0.02
65 0.03
66 0.03
67 0.04
68 0.04
69 0.05
70 0.07
71 0.09
72 0.1
73 0.11
74 0.13
75 0.13
76 0.14
77 0.14
78 0.17
79 0.16
80 0.16
81 0.18
82 0.17
83 0.19
84 0.21
85 0.22
86 0.2
87 0.2
88 0.2
89 0.2
90 0.25
91 0.3
92 0.33
93 0.4
94 0.44
95 0.5
96 0.54
97 0.52
98 0.54
99 0.5
100 0.45
101 0.37
102 0.31
103 0.26
104 0.2
105 0.19
106 0.12
107 0.09
108 0.07
109 0.06
110 0.06
111 0.05
112 0.04
113 0.05
114 0.05
115 0.06
116 0.09
117 0.08
118 0.09
119 0.09
120 0.12
121 0.18
122 0.21
123 0.24
124 0.31
125 0.36
126 0.37
127 0.39
128 0.37
129 0.31
130 0.29
131 0.25
132 0.17
133 0.13
134 0.11
135 0.11
136 0.11
137 0.11
138 0.1
139 0.09
140 0.08
141 0.07
142 0.06
143 0.05
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.06
150 0.08
151 0.14
152 0.22
153 0.32
154 0.42
155 0.52
156 0.62
157 0.71
158 0.8
159 0.85
160 0.88
161 0.88
162 0.89
163 0.91
164 0.91
165 0.91
166 0.85
167 0.81
168 0.79
169 0.78
170 0.78
171 0.77
172 0.77
173 0.74
174 0.79
175 0.73
176 0.66
177 0.59
178 0.5
179 0.42
180 0.31
181 0.24
182 0.14
183 0.14
184 0.12
185 0.1
186 0.09
187 0.06
188 0.06
189 0.08
190 0.12
191 0.1
192 0.13
193 0.18
194 0.21
195 0.26
196 0.31
197 0.34
198 0.39
199 0.46
200 0.51
201 0.52
202 0.59
203 0.55
204 0.52
205 0.51
206 0.49
207 0.43
208 0.37
209 0.33
210 0.26
211 0.27
212 0.26
213 0.21
214 0.16
215 0.14
216 0.13
217 0.11
218 0.12
219 0.09
220 0.09
221 0.09
222 0.08
223 0.08
224 0.08
225 0.07
226 0.05
227 0.04
228 0.04
229 0.04
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.06
237 0.06
238 0.06
239 0.06
240 0.07
241 0.07
242 0.08
243 0.08
244 0.1
245 0.14
246 0.15
247 0.19
248 0.22
249 0.23
250 0.25
251 0.3
252 0.3
253 0.33
254 0.39
255 0.41
256 0.45
257 0.52
258 0.54
259 0.53
260 0.54
261 0.54
262 0.55
263 0.56
264 0.57
265 0.55
266 0.53
267 0.5
268 0.5
269 0.46
270 0.44
271 0.44
272 0.4
273 0.43
274 0.45
275 0.47
276 0.49
277 0.5
278 0.48
279 0.51
280 0.51
281 0.49
282 0.47
283 0.46
284 0.45
285 0.47
286 0.49
287 0.45
288 0.43
289 0.45
290 0.44
291 0.44
292 0.48
293 0.47
294 0.48
295 0.51
296 0.55
297 0.47
298 0.48
299 0.47
300 0.46
301 0.44
302 0.38
303 0.33
304 0.26
305 0.26
306 0.24
307 0.21
308 0.15
309 0.14
310 0.13
311 0.11
312 0.12
313 0.11
314 0.1
315 0.1
316 0.11
317 0.1
318 0.09
319 0.09
320 0.09
321 0.09
322 0.09
323 0.09
324 0.09
325 0.08
326 0.08
327 0.07
328 0.06
329 0.07
330 0.07
331 0.07
332 0.06
333 0.06
334 0.07
335 0.09
336 0.1
337 0.1
338 0.1
339 0.11
340 0.11
341 0.13
342 0.14
343 0.13
344 0.12
345 0.12
346 0.14
347 0.17
348 0.24
349 0.25
350 0.25
351 0.28
352 0.34
353 0.41
354 0.5
355 0.56
356 0.57
357 0.64
358 0.72
359 0.79
360 0.82
361 0.84
362 0.84
363 0.85
364 0.87
365 0.89
366 0.91
367 0.91
368 0.91
369 0.88
370 0.88
371 0.87
372 0.86
373 0.86
374 0.86
375 0.85
376 0.8
377 0.83
378 0.79
379 0.79
380 0.72