Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4A902

Protein Details
Accession A0A2T4A902    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-103KRSMRKSCYRCVIKKRKCERARPCGGCIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MSPPNNRRVLSPSLQCPHCTKAFSRPSHLDRHQLTHLPPSLKAVLPCPRCDKSFSRRDVLFRHLRASHLIKQPNIKRSMRKSCYRCVIKKRKCERARPCGGCIESQVPCEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.51
4 0.49
5 0.45
6 0.42
7 0.35
8 0.38
9 0.45
10 0.46
11 0.5
12 0.53
13 0.53
14 0.59
15 0.6
16 0.58
17 0.51
18 0.53
19 0.49
20 0.45
21 0.42
22 0.39
23 0.41
24 0.33
25 0.31
26 0.29
27 0.28
28 0.25
29 0.25
30 0.23
31 0.27
32 0.27
33 0.3
34 0.33
35 0.33
36 0.33
37 0.37
38 0.38
39 0.38
40 0.45
41 0.45
42 0.44
43 0.43
44 0.45
45 0.44
46 0.45
47 0.44
48 0.36
49 0.38
50 0.33
51 0.32
52 0.34
53 0.36
54 0.36
55 0.36
56 0.39
57 0.37
58 0.45
59 0.5
60 0.53
61 0.55
62 0.51
63 0.52
64 0.58
65 0.67
66 0.65
67 0.69
68 0.67
69 0.68
70 0.75
71 0.76
72 0.75
73 0.75
74 0.8
75 0.79
76 0.85
77 0.86
78 0.87
79 0.86
80 0.88
81 0.88
82 0.87
83 0.89
84 0.84
85 0.77
86 0.75
87 0.68
88 0.59
89 0.53
90 0.48
91 0.39