Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AFT1

Protein Details
Accession A0A2T4AFT1    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
293-322WRCDVPGCPNPPKKRRFARRDGLERHKATVHydrophilic
NLS Segment(s)
PositionSequence
304-313PKKRRFARRD
Subcellular Location(s) nucl 19, mito 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MPPLSTTHVFKFGLTTPPATESLEELIQQHLKQAARKVELAAGDLFSASVPSSESCSAEPRDVAALVTEMGDYLARTAMIWSSLIQSLIQGPHIDQVTLQILEKSRADTRVSDLAASVSMDVTLSRLRKMRDLAEQYARDVQTVWTVGGRRSSLASHAPRMSISSHDGPPSAAPSVTSSATSLDMQEAPDTLSRAPKRRKQLPDAAAVQPTPASDATATGANPPEQDESDDYSDENEFAGINMKALKQRGKGKYYCPRGHQCDKGGVDKHGNLILFDRNSSFAYVVISPFSPWRCDVPGCPNPPKKRRFARRDGLERHKATVKHYFMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.26
4 0.29
5 0.31
6 0.28
7 0.25
8 0.2
9 0.21
10 0.19
11 0.18
12 0.16
13 0.19
14 0.21
15 0.2
16 0.21
17 0.23
18 0.25
19 0.29
20 0.35
21 0.38
22 0.39
23 0.4
24 0.39
25 0.37
26 0.35
27 0.33
28 0.27
29 0.19
30 0.16
31 0.14
32 0.12
33 0.09
34 0.08
35 0.06
36 0.05
37 0.06
38 0.06
39 0.1
40 0.12
41 0.13
42 0.14
43 0.19
44 0.21
45 0.21
46 0.21
47 0.18
48 0.19
49 0.18
50 0.16
51 0.12
52 0.11
53 0.09
54 0.09
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.09
70 0.1
71 0.1
72 0.09
73 0.09
74 0.11
75 0.11
76 0.12
77 0.1
78 0.1
79 0.13
80 0.13
81 0.13
82 0.1
83 0.12
84 0.13
85 0.14
86 0.13
87 0.12
88 0.13
89 0.15
90 0.15
91 0.16
92 0.16
93 0.18
94 0.19
95 0.18
96 0.22
97 0.24
98 0.24
99 0.21
100 0.19
101 0.17
102 0.15
103 0.14
104 0.1
105 0.05
106 0.05
107 0.04
108 0.04
109 0.05
110 0.08
111 0.09
112 0.11
113 0.14
114 0.16
115 0.19
116 0.22
117 0.24
118 0.29
119 0.34
120 0.36
121 0.41
122 0.4
123 0.38
124 0.4
125 0.37
126 0.28
127 0.23
128 0.19
129 0.14
130 0.14
131 0.12
132 0.09
133 0.1
134 0.11
135 0.13
136 0.13
137 0.11
138 0.11
139 0.12
140 0.12
141 0.18
142 0.19
143 0.21
144 0.21
145 0.21
146 0.2
147 0.21
148 0.19
149 0.14
150 0.16
151 0.15
152 0.16
153 0.16
154 0.16
155 0.15
156 0.15
157 0.14
158 0.11
159 0.08
160 0.07
161 0.08
162 0.1
163 0.1
164 0.1
165 0.09
166 0.09
167 0.1
168 0.1
169 0.09
170 0.08
171 0.08
172 0.08
173 0.08
174 0.07
175 0.07
176 0.08
177 0.09
178 0.08
179 0.15
180 0.18
181 0.27
182 0.35
183 0.4
184 0.49
185 0.57
186 0.64
187 0.64
188 0.71
189 0.67
190 0.66
191 0.64
192 0.57
193 0.49
194 0.41
195 0.34
196 0.24
197 0.19
198 0.14
199 0.09
200 0.08
201 0.06
202 0.07
203 0.08
204 0.09
205 0.09
206 0.09
207 0.11
208 0.1
209 0.11
210 0.12
211 0.12
212 0.11
213 0.14
214 0.14
215 0.17
216 0.18
217 0.18
218 0.16
219 0.16
220 0.16
221 0.14
222 0.12
223 0.08
224 0.06
225 0.06
226 0.09
227 0.08
228 0.08
229 0.1
230 0.11
231 0.14
232 0.18
233 0.23
234 0.27
235 0.36
236 0.43
237 0.49
238 0.52
239 0.59
240 0.66
241 0.71
242 0.7
243 0.69
244 0.71
245 0.72
246 0.76
247 0.73
248 0.67
249 0.65
250 0.62
251 0.61
252 0.55
253 0.5
254 0.47
255 0.41
256 0.4
257 0.34
258 0.31
259 0.24
260 0.23
261 0.25
262 0.21
263 0.2
264 0.19
265 0.18
266 0.19
267 0.2
268 0.18
269 0.12
270 0.14
271 0.14
272 0.14
273 0.14
274 0.13
275 0.13
276 0.17
277 0.19
278 0.18
279 0.19
280 0.23
281 0.25
282 0.27
283 0.31
284 0.37
285 0.44
286 0.49
287 0.57
288 0.63
289 0.69
290 0.76
291 0.79
292 0.79
293 0.82
294 0.86
295 0.86
296 0.87
297 0.87
298 0.89
299 0.91
300 0.91
301 0.9
302 0.89
303 0.81
304 0.76
305 0.72
306 0.63
307 0.58
308 0.58