Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4A6J9

Protein Details
Accession A0A2T4A6J9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
37-87EVIMEREKRKRKEERRIAKEERRAAKEERRAAKEQRRRERQSQKKEFDWRDBasic
NLS Segment(s)
PositionSequence
42-80REKRKRKEERRIAKEERRAAKEERRAAKEQRRRERQSQK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MGLWRPIAKLEVKLETWRWRSRYTVLERTPAEPEWWEVIMEREKRKRKEERRIAKEERRAAKEERRAAKEQRRRERQSQKKEFDWRDYIPRFPKVVGYTPMWKLDEMLASPQGVRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.48
4 0.5
5 0.49
6 0.47
7 0.49
8 0.49
9 0.53
10 0.52
11 0.56
12 0.51
13 0.55
14 0.54
15 0.52
16 0.5
17 0.42
18 0.35
19 0.25
20 0.24
21 0.19
22 0.18
23 0.16
24 0.13
25 0.15
26 0.21
27 0.25
28 0.29
29 0.36
30 0.44
31 0.49
32 0.57
33 0.65
34 0.68
35 0.75
36 0.79
37 0.81
38 0.81
39 0.85
40 0.85
41 0.82
42 0.79
43 0.76
44 0.71
45 0.64
46 0.59
47 0.54
48 0.53
49 0.53
50 0.54
51 0.53
52 0.52
53 0.52
54 0.57
55 0.63
56 0.63
57 0.66
58 0.69
59 0.72
60 0.74
61 0.8
62 0.83
63 0.84
64 0.87
65 0.87
66 0.82
67 0.8
68 0.83
69 0.77
70 0.73
71 0.68
72 0.61
73 0.6
74 0.56
75 0.55
76 0.51
77 0.51
78 0.45
79 0.4
80 0.42
81 0.36
82 0.4
83 0.37
84 0.36
85 0.37
86 0.39
87 0.43
88 0.39
89 0.34
90 0.3
91 0.28
92 0.27
93 0.22
94 0.23
95 0.2
96 0.19