Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4AJ70

Protein Details
Accession A0A2T4AJ70    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
233-260GKATNGGPRKPGRPKKDKKAAPVVGKTLBasic
NLS Segment(s)
PositionSequence
232-262NGKATNGGPRKPGRPKKDKKAAPVVGKTLRK
Subcellular Location(s) cyto 18, cyto_nucl 14.333, nucl 8.5, mito_nucl 5.166
Family & Domain DBs
Amino Acid Sequences MSDGIAPAVDKVGPPVPTAPEAQAGAPTMAMDTDTAKPETVNLPTSLEKPKEPPIIAETKAPEEAKPTEEPLSIADAFKLAHKTPRPVEVQSVPETPVNLATPVNGSPRPELNIPTEPAEPEKPQEEPVIITEAEEPLPTPTASAPGSDVGPDSIVDKPVTPNGESKPAELMAGALQPSAADAKSETSETATGEKRKADAAVATAVDEPAAEKEESEDSEPADKKAKLDNGNGKATNGGPRKPGRPKKDKKAAPVVGKTLRKTRSQGPVEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.21
4 0.23
5 0.25
6 0.23
7 0.22
8 0.22
9 0.21
10 0.2
11 0.18
12 0.16
13 0.14
14 0.12
15 0.09
16 0.08
17 0.08
18 0.07
19 0.08
20 0.11
21 0.14
22 0.15
23 0.15
24 0.15
25 0.16
26 0.2
27 0.2
28 0.2
29 0.18
30 0.21
31 0.22
32 0.26
33 0.31
34 0.3
35 0.29
36 0.3
37 0.37
38 0.4
39 0.39
40 0.38
41 0.36
42 0.4
43 0.39
44 0.39
45 0.33
46 0.29
47 0.33
48 0.31
49 0.25
50 0.24
51 0.25
52 0.24
53 0.23
54 0.24
55 0.22
56 0.22
57 0.22
58 0.18
59 0.21
60 0.18
61 0.16
62 0.14
63 0.12
64 0.12
65 0.14
66 0.16
67 0.12
68 0.19
69 0.22
70 0.27
71 0.29
72 0.35
73 0.37
74 0.35
75 0.39
76 0.36
77 0.37
78 0.35
79 0.34
80 0.29
81 0.26
82 0.25
83 0.2
84 0.17
85 0.13
86 0.11
87 0.09
88 0.08
89 0.09
90 0.1
91 0.13
92 0.12
93 0.13
94 0.14
95 0.15
96 0.18
97 0.17
98 0.18
99 0.2
100 0.22
101 0.22
102 0.23
103 0.22
104 0.2
105 0.21
106 0.21
107 0.17
108 0.16
109 0.16
110 0.14
111 0.15
112 0.15
113 0.13
114 0.11
115 0.11
116 0.12
117 0.11
118 0.1
119 0.09
120 0.09
121 0.09
122 0.08
123 0.07
124 0.05
125 0.06
126 0.06
127 0.06
128 0.05
129 0.08
130 0.08
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.08
143 0.08
144 0.08
145 0.09
146 0.11
147 0.13
148 0.13
149 0.15
150 0.16
151 0.24
152 0.24
153 0.24
154 0.23
155 0.22
156 0.21
157 0.17
158 0.16
159 0.08
160 0.09
161 0.08
162 0.06
163 0.05
164 0.05
165 0.06
166 0.06
167 0.05
168 0.04
169 0.05
170 0.07
171 0.08
172 0.09
173 0.09
174 0.09
175 0.1
176 0.11
177 0.15
178 0.18
179 0.2
180 0.21
181 0.22
182 0.22
183 0.22
184 0.22
185 0.19
186 0.15
187 0.14
188 0.15
189 0.14
190 0.14
191 0.13
192 0.12
193 0.11
194 0.09
195 0.08
196 0.06
197 0.09
198 0.08
199 0.07
200 0.1
201 0.12
202 0.14
203 0.16
204 0.15
205 0.14
206 0.21
207 0.22
208 0.22
209 0.27
210 0.26
211 0.25
212 0.32
213 0.38
214 0.36
215 0.44
216 0.53
217 0.52
218 0.59
219 0.58
220 0.51
221 0.45
222 0.42
223 0.42
224 0.37
225 0.34
226 0.34
227 0.39
228 0.48
229 0.57
230 0.65
231 0.67
232 0.73
233 0.81
234 0.85
235 0.9
236 0.89
237 0.87
238 0.88
239 0.86
240 0.85
241 0.81
242 0.78
243 0.76
244 0.75
245 0.7
246 0.67
247 0.63
248 0.6
249 0.58
250 0.58
251 0.6