Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4A6X2

Protein Details
Accession A0A2T4A6X2    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-105GLDLSLLKKKKKKKTKVEGVEADAHydrophilic
118-141GLDLTMKKKKKKVKKAEGAEEDEFBasic
NLS Segment(s)
PositionSequence
89-97KKKKKKKTK
124-133KKKKKKVKKA
Subcellular Location(s) nucl 16, cyto_nucl 13.333, cyto 9.5, mito_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR045196  IF2/IF5  
IPR002735  Transl_init_fac_IF2/IF5_dom  
IPR016189  Transl_init_fac_IF2/IF5_N  
IPR016190  Transl_init_fac_IF2/IF5_Zn-bd  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01873  eIF-5_eIF-2B  
Amino Acid Sequences MDNEVLDQLERKPSRKSVAFTDEQLVVETDGSITIMSAVEEPKETAQSHTPRTPPLSAALEAFADTSSQAAADELAPPEDGGLDLSLLKKKKKKKTKVEGVEADADAEDGAAPAEDGGLDLTMKKKKKKVKKAEGAEEDEFTAKLKQLEVKDAEEAEEAAQEDEGDMETGTGVWAHDESKTIPYTMLLSRFFTVLSQKNPDHSLSGTKSYKIPPPQCMREGNRKTVFANIADISKRMKRTEEHLTAYLFAELGTNGSVDGNRRLVIKGRFQQKQIENVVRKYIIEYVTCKTCRSPDTELNKGENRLYFITCNNCASRRSVTAIKTGFSAQIGKRKKMQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.54
4 0.53
5 0.58
6 0.59
7 0.55
8 0.53
9 0.46
10 0.4
11 0.37
12 0.28
13 0.2
14 0.17
15 0.14
16 0.1
17 0.08
18 0.07
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.07
25 0.08
26 0.08
27 0.09
28 0.11
29 0.12
30 0.15
31 0.16
32 0.18
33 0.25
34 0.31
35 0.36
36 0.41
37 0.42
38 0.44
39 0.47
40 0.46
41 0.39
42 0.38
43 0.35
44 0.3
45 0.28
46 0.25
47 0.2
48 0.18
49 0.17
50 0.12
51 0.08
52 0.07
53 0.06
54 0.05
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.07
61 0.08
62 0.08
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.05
69 0.05
70 0.05
71 0.06
72 0.08
73 0.13
74 0.16
75 0.23
76 0.29
77 0.39
78 0.49
79 0.59
80 0.68
81 0.75
82 0.83
83 0.88
84 0.91
85 0.91
86 0.86
87 0.78
88 0.71
89 0.6
90 0.48
91 0.37
92 0.27
93 0.16
94 0.11
95 0.07
96 0.03
97 0.03
98 0.03
99 0.03
100 0.02
101 0.02
102 0.02
103 0.02
104 0.03
105 0.03
106 0.03
107 0.04
108 0.08
109 0.15
110 0.2
111 0.25
112 0.32
113 0.42
114 0.53
115 0.63
116 0.71
117 0.76
118 0.82
119 0.85
120 0.88
121 0.85
122 0.8
123 0.7
124 0.59
125 0.48
126 0.38
127 0.29
128 0.2
129 0.14
130 0.09
131 0.09
132 0.09
133 0.13
134 0.13
135 0.19
136 0.2
137 0.21
138 0.2
139 0.2
140 0.2
141 0.15
142 0.15
143 0.09
144 0.08
145 0.07
146 0.06
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.04
163 0.04
164 0.05
165 0.06
166 0.09
167 0.1
168 0.1
169 0.09
170 0.09
171 0.12
172 0.12
173 0.15
174 0.13
175 0.14
176 0.15
177 0.15
178 0.14
179 0.12
180 0.16
181 0.16
182 0.18
183 0.22
184 0.22
185 0.25
186 0.27
187 0.27
188 0.23
189 0.2
190 0.23
191 0.2
192 0.27
193 0.26
194 0.25
195 0.27
196 0.28
197 0.33
198 0.36
199 0.38
200 0.39
201 0.46
202 0.5
203 0.52
204 0.56
205 0.56
206 0.58
207 0.59
208 0.6
209 0.56
210 0.52
211 0.49
212 0.46
213 0.43
214 0.32
215 0.3
216 0.22
217 0.21
218 0.2
219 0.2
220 0.19
221 0.21
222 0.23
223 0.22
224 0.24
225 0.24
226 0.29
227 0.38
228 0.41
229 0.41
230 0.41
231 0.4
232 0.38
233 0.36
234 0.31
235 0.2
236 0.14
237 0.09
238 0.07
239 0.07
240 0.06
241 0.05
242 0.05
243 0.05
244 0.06
245 0.08
246 0.11
247 0.12
248 0.13
249 0.14
250 0.15
251 0.22
252 0.26
253 0.33
254 0.37
255 0.45
256 0.49
257 0.5
258 0.58
259 0.56
260 0.59
261 0.59
262 0.61
263 0.57
264 0.55
265 0.58
266 0.5
267 0.45
268 0.39
269 0.35
270 0.28
271 0.26
272 0.26
273 0.25
274 0.33
275 0.33
276 0.33
277 0.3
278 0.33
279 0.34
280 0.37
281 0.41
282 0.42
283 0.49
284 0.56
285 0.58
286 0.59
287 0.61
288 0.57
289 0.52
290 0.45
291 0.41
292 0.36
293 0.34
294 0.3
295 0.3
296 0.34
297 0.34
298 0.36
299 0.36
300 0.36
301 0.35
302 0.38
303 0.38
304 0.35
305 0.38
306 0.4
307 0.39
308 0.44
309 0.45
310 0.41
311 0.38
312 0.35
313 0.31
314 0.26
315 0.3
316 0.26
317 0.34
318 0.4
319 0.43