Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZTQ5

Protein Details
Accession A0A2T3ZTQ5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSSRSSSKKFNNQRKAASIHydrophilic
61-88KKPNRPFSAKKGINKKRKKSSIVFPKYSHydrophilic
NLS Segment(s)
PositionSequence
61-102KKPNRPFSAKKGINKKRKKSSIVFPKYSDRLRKTARNAPKKA
Subcellular Location(s) nucl 16, mito 10, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSSKKFNNQRKAASIFGPAETARQERLSAKLLELAKQAKPEPAEMKIDAMDVDSKKPNRPFSAKKGINKKRKKSSIVFPKYSDRLRKTARNAPKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.8
4 0.74
5 0.65
6 0.56
7 0.51
8 0.42
9 0.34
10 0.3
11 0.23
12 0.2
13 0.19
14 0.19
15 0.15
16 0.14
17 0.16
18 0.15
19 0.18
20 0.21
21 0.19
22 0.18
23 0.22
24 0.22
25 0.22
26 0.23
27 0.23
28 0.2
29 0.22
30 0.22
31 0.19
32 0.19
33 0.2
34 0.2
35 0.19
36 0.2
37 0.18
38 0.18
39 0.16
40 0.15
41 0.12
42 0.1
43 0.11
44 0.09
45 0.11
46 0.16
47 0.17
48 0.23
49 0.28
50 0.33
51 0.35
52 0.43
53 0.47
54 0.51
55 0.61
56 0.61
57 0.64
58 0.71
59 0.75
60 0.78
61 0.82
62 0.83
63 0.83
64 0.85
65 0.85
66 0.8
67 0.81
68 0.82
69 0.81
70 0.76
71 0.69
72 0.69
73 0.68
74 0.69
75 0.67
76 0.61
77 0.6
78 0.63
79 0.68
80 0.68
81 0.71
82 0.74