Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AIH8

Protein Details
Accession A0A2T4AIH8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
92-115DGKVTKKPKARTPKKAVAKKEESEBasic
NLS Segment(s)
PositionSequence
80-84KGKKN
88-111GPSGDGKVTKKPKARTPKKAVAKK
Subcellular Location(s) nucl 16, cyto_nucl 11.5, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MPAKKADSSDSPSVTTGLRENELRFIKAVFDNMTQKPDADWGKVAGDLGLKDAKCAKERFRQMSVRHGWRTGAPNGSPSKGKKNDVTGPSGDGKVTKKPKARTPKKAVAKKEESEDDDIKDEDDYLKSEEIEGDAYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.26
3 0.22
4 0.19
5 0.2
6 0.21
7 0.21
8 0.28
9 0.3
10 0.29
11 0.26
12 0.23
13 0.24
14 0.22
15 0.24
16 0.18
17 0.2
18 0.25
19 0.26
20 0.28
21 0.25
22 0.24
23 0.22
24 0.25
25 0.23
26 0.19
27 0.19
28 0.17
29 0.17
30 0.17
31 0.17
32 0.11
33 0.1
34 0.09
35 0.1
36 0.12
37 0.11
38 0.11
39 0.15
40 0.17
41 0.2
42 0.23
43 0.27
44 0.32
45 0.39
46 0.44
47 0.47
48 0.51
49 0.49
50 0.56
51 0.57
52 0.55
53 0.49
54 0.45
55 0.39
56 0.35
57 0.37
58 0.3
59 0.26
60 0.19
61 0.23
62 0.24
63 0.25
64 0.25
65 0.23
66 0.3
67 0.32
68 0.35
69 0.34
70 0.39
71 0.45
72 0.44
73 0.46
74 0.37
75 0.35
76 0.34
77 0.31
78 0.25
79 0.2
80 0.19
81 0.24
82 0.3
83 0.34
84 0.39
85 0.45
86 0.54
87 0.63
88 0.71
89 0.74
90 0.77
91 0.8
92 0.83
93 0.86
94 0.85
95 0.83
96 0.81
97 0.73
98 0.7
99 0.65
100 0.59
101 0.57
102 0.51
103 0.43
104 0.38
105 0.34
106 0.28
107 0.23
108 0.19
109 0.15
110 0.14
111 0.14
112 0.14
113 0.15
114 0.15
115 0.15
116 0.15
117 0.14