Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4AGY1

Protein Details
Accession A0A2T4AGY1    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
44-65KAVSGRKKRAIQPKKRARHAESBasic
NLS Segment(s)
PositionSequence
48-61GRKKRAIQPKKRAR
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
Amino Acid Sequences PAAKRSAPKQEAAGTRRRSGRLSSTQVKSAYFEGSSDDEEEEEKAVSGRKKRAIQPKKRARHAESESEGEQYKEESEEEAEVQPKKRSRGHEDDKDDEDDEDDDDGPRKVTIIPLEKMRDTGGVEYEDHKVHKNTMLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.58
4 0.56
5 0.51
6 0.47
7 0.51
8 0.51
9 0.54
10 0.56
11 0.54
12 0.56
13 0.55
14 0.51
15 0.44
16 0.36
17 0.3
18 0.21
19 0.18
20 0.15
21 0.16
22 0.16
23 0.15
24 0.14
25 0.12
26 0.12
27 0.12
28 0.1
29 0.08
30 0.07
31 0.07
32 0.1
33 0.14
34 0.19
35 0.25
36 0.31
37 0.37
38 0.44
39 0.55
40 0.62
41 0.69
42 0.74
43 0.79
44 0.81
45 0.84
46 0.84
47 0.77
48 0.76
49 0.7
50 0.66
51 0.59
52 0.53
53 0.45
54 0.39
55 0.35
56 0.25
57 0.2
58 0.13
59 0.1
60 0.07
61 0.07
62 0.06
63 0.06
64 0.07
65 0.08
66 0.09
67 0.11
68 0.13
69 0.15
70 0.19
71 0.22
72 0.27
73 0.31
74 0.36
75 0.42
76 0.51
77 0.58
78 0.62
79 0.66
80 0.66
81 0.64
82 0.6
83 0.51
84 0.41
85 0.33
86 0.23
87 0.17
88 0.14
89 0.11
90 0.09
91 0.1
92 0.1
93 0.1
94 0.09
95 0.09
96 0.09
97 0.12
98 0.18
99 0.23
100 0.25
101 0.31
102 0.36
103 0.35
104 0.36
105 0.34
106 0.29
107 0.25
108 0.24
109 0.2
110 0.18
111 0.18
112 0.19
113 0.22
114 0.22
115 0.22
116 0.25
117 0.24
118 0.25