Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T3ZR59

Protein Details
Accession A0A2T3ZR59    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
7-28LSNKLNYKKVRPYKILKKISKVHydrophilic
NLS Segment(s)
PositionSequence
71-80IIIKGKKLKY
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences NIKINRLSNKLNYKKVRPYKILKKISKVNYKLNLLKQLSKQGKPVHLIFYILLLKKTLINKNTKELIKNKIIIKGKKLKYKVNKIILLKIGKVTNKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.8
4 0.77
5 0.78
6 0.79
7 0.82
8 0.85
9 0.8
10 0.78
11 0.78
12 0.8
13 0.8
14 0.74
15 0.72
16 0.68
17 0.69
18 0.67
19 0.62
20 0.61
21 0.53
22 0.52
23 0.46
24 0.49
25 0.48
26 0.44
27 0.46
28 0.41
29 0.42
30 0.41
31 0.4
32 0.34
33 0.28
34 0.27
35 0.21
36 0.19
37 0.19
38 0.16
39 0.14
40 0.11
41 0.11
42 0.14
43 0.19
44 0.22
45 0.24
46 0.31
47 0.33
48 0.38
49 0.45
50 0.43
51 0.44
52 0.43
53 0.45
54 0.44
55 0.47
56 0.44
57 0.45
58 0.51
59 0.49
60 0.53
61 0.57
62 0.59
63 0.62
64 0.65
65 0.67
66 0.7
67 0.77
68 0.79
69 0.78
70 0.78
71 0.72
72 0.74
73 0.72
74 0.65
75 0.55
76 0.5
77 0.46