Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4HA28

Protein Details
Accession A0A2T4HA28    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
399-420YGSANIRRRRKPDSVRKRAGHGBasic
NLS Segment(s)
PositionSequence
229-251PRRKPAFQASGRVKKRHSKRPGA
405-416RRRRKPDSVRKR
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
Amino Acid Sequences MIMVEQQYIAPGLPQQAGFSGAPTLLDSIPTTAASAYHELAAYSSISSSYNGIPCDPNLLTPVSVIDSPPLHGLTKIQYPPPPSTPNQQPSPPGSSEMYHQQWAGHFDVNGQSPSASSPMTSQAPGGGEFLHASYVHDGRRTPGPPEPYMGAFGVSNAPEPPSMDHPYYVDMGPPVDHQVQMGIHHREMPGAPLLSESQPIQYRRRHSPEDPAPQNRSAGVPRSLTESPRRKPAFQASGRVKKRHSKRPGASRTAAQEDPMSEHKNCFGEEAPPKIKSNCPDEERCIFESRWRHRHQKGQDMWDSIQNDYYNRFGKRPGKEMLQMKFKRGRAKYLDWISKDVDLLHEAWLINEKNRYQNTLDIFYEMGGSRNMRLNASDIEIKVVNDLKLEEGIYMESYGSANIRRRRKPDSVRKRAGHGVGNDMSVNDEMMSIGSHTTHEDEVINQVHGLPNMKMEEQGPGDHPNMMETQMWDQQMKMEPGTMPQRNDHIQHSMGPSPISQPMYGARREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.19
5 0.18
6 0.17
7 0.15
8 0.13
9 0.13
10 0.13
11 0.14
12 0.1
13 0.12
14 0.11
15 0.12
16 0.13
17 0.13
18 0.13
19 0.1
20 0.11
21 0.13
22 0.15
23 0.14
24 0.14
25 0.14
26 0.13
27 0.13
28 0.14
29 0.11
30 0.09
31 0.08
32 0.08
33 0.09
34 0.1
35 0.11
36 0.14
37 0.17
38 0.18
39 0.2
40 0.21
41 0.2
42 0.25
43 0.23
44 0.2
45 0.19
46 0.2
47 0.18
48 0.16
49 0.17
50 0.13
51 0.13
52 0.13
53 0.14
54 0.13
55 0.14
56 0.16
57 0.16
58 0.14
59 0.14
60 0.16
61 0.17
62 0.25
63 0.27
64 0.29
65 0.31
66 0.35
67 0.4
68 0.44
69 0.46
70 0.42
71 0.47
72 0.52
73 0.56
74 0.57
75 0.55
76 0.54
77 0.53
78 0.56
79 0.49
80 0.42
81 0.36
82 0.32
83 0.31
84 0.34
85 0.32
86 0.28
87 0.27
88 0.25
89 0.25
90 0.28
91 0.28
92 0.21
93 0.18
94 0.18
95 0.22
96 0.23
97 0.21
98 0.17
99 0.15
100 0.13
101 0.14
102 0.14
103 0.1
104 0.08
105 0.09
106 0.13
107 0.15
108 0.15
109 0.14
110 0.15
111 0.16
112 0.16
113 0.15
114 0.11
115 0.09
116 0.1
117 0.1
118 0.09
119 0.08
120 0.08
121 0.11
122 0.13
123 0.14
124 0.16
125 0.16
126 0.17
127 0.24
128 0.24
129 0.25
130 0.28
131 0.32
132 0.31
133 0.34
134 0.33
135 0.27
136 0.28
137 0.24
138 0.19
139 0.14
140 0.13
141 0.13
142 0.11
143 0.11
144 0.09
145 0.09
146 0.09
147 0.1
148 0.12
149 0.15
150 0.18
151 0.18
152 0.19
153 0.19
154 0.2
155 0.21
156 0.19
157 0.14
158 0.11
159 0.11
160 0.11
161 0.1
162 0.12
163 0.11
164 0.11
165 0.1
166 0.12
167 0.12
168 0.14
169 0.19
170 0.18
171 0.18
172 0.2
173 0.2
174 0.19
175 0.19
176 0.18
177 0.15
178 0.12
179 0.12
180 0.11
181 0.12
182 0.11
183 0.12
184 0.11
185 0.12
186 0.16
187 0.2
188 0.24
189 0.28
190 0.33
191 0.41
192 0.47
193 0.5
194 0.47
195 0.54
196 0.58
197 0.63
198 0.64
199 0.62
200 0.59
201 0.54
202 0.52
203 0.43
204 0.35
205 0.27
206 0.24
207 0.21
208 0.18
209 0.17
210 0.22
211 0.23
212 0.24
213 0.31
214 0.35
215 0.35
216 0.44
217 0.46
218 0.41
219 0.45
220 0.51
221 0.51
222 0.46
223 0.53
224 0.52
225 0.59
226 0.63
227 0.62
228 0.57
229 0.55
230 0.61
231 0.63
232 0.63
233 0.64
234 0.67
235 0.74
236 0.79
237 0.77
238 0.71
239 0.63
240 0.57
241 0.51
242 0.43
243 0.33
244 0.25
245 0.19
246 0.19
247 0.2
248 0.19
249 0.15
250 0.15
251 0.17
252 0.17
253 0.17
254 0.15
255 0.13
256 0.16
257 0.19
258 0.25
259 0.25
260 0.26
261 0.27
262 0.28
263 0.3
264 0.28
265 0.31
266 0.31
267 0.33
268 0.34
269 0.38
270 0.39
271 0.4
272 0.39
273 0.36
274 0.29
275 0.3
276 0.36
277 0.39
278 0.46
279 0.48
280 0.54
281 0.56
282 0.65
283 0.67
284 0.68
285 0.66
286 0.64
287 0.63
288 0.58
289 0.54
290 0.5
291 0.44
292 0.34
293 0.31
294 0.23
295 0.19
296 0.17
297 0.2
298 0.2
299 0.2
300 0.2
301 0.24
302 0.32
303 0.35
304 0.39
305 0.39
306 0.39
307 0.44
308 0.5
309 0.49
310 0.52
311 0.49
312 0.5
313 0.54
314 0.53
315 0.55
316 0.5
317 0.53
318 0.49
319 0.54
320 0.57
321 0.58
322 0.61
323 0.54
324 0.55
325 0.48
326 0.42
327 0.36
328 0.27
329 0.19
330 0.14
331 0.13
332 0.11
333 0.12
334 0.11
335 0.11
336 0.16
337 0.15
338 0.16
339 0.19
340 0.2
341 0.25
342 0.27
343 0.3
344 0.27
345 0.31
346 0.33
347 0.33
348 0.32
349 0.25
350 0.24
351 0.21
352 0.21
353 0.16
354 0.13
355 0.1
356 0.1
357 0.11
358 0.16
359 0.17
360 0.16
361 0.16
362 0.18
363 0.18
364 0.21
365 0.22
366 0.17
367 0.19
368 0.19
369 0.18
370 0.18
371 0.19
372 0.16
373 0.13
374 0.14
375 0.12
376 0.12
377 0.12
378 0.1
379 0.08
380 0.08
381 0.08
382 0.08
383 0.07
384 0.07
385 0.06
386 0.07
387 0.08
388 0.12
389 0.19
390 0.27
391 0.36
392 0.43
393 0.49
394 0.57
395 0.66
396 0.72
397 0.76
398 0.8
399 0.81
400 0.85
401 0.82
402 0.8
403 0.77
404 0.7
405 0.65
406 0.56
407 0.52
408 0.43
409 0.41
410 0.35
411 0.28
412 0.25
413 0.18
414 0.16
415 0.09
416 0.07
417 0.06
418 0.06
419 0.07
420 0.05
421 0.06
422 0.06
423 0.06
424 0.08
425 0.1
426 0.1
427 0.11
428 0.11
429 0.12
430 0.16
431 0.18
432 0.17
433 0.15
434 0.15
435 0.16
436 0.17
437 0.19
438 0.15
439 0.17
440 0.19
441 0.19
442 0.19
443 0.18
444 0.21
445 0.21
446 0.23
447 0.22
448 0.23
449 0.24
450 0.24
451 0.24
452 0.2
453 0.2
454 0.19
455 0.18
456 0.16
457 0.2
458 0.22
459 0.25
460 0.23
461 0.22
462 0.25
463 0.3
464 0.31
465 0.27
466 0.25
467 0.23
468 0.29
469 0.39
470 0.4
471 0.36
472 0.37
473 0.43
474 0.45
475 0.48
476 0.45
477 0.41
478 0.37
479 0.4
480 0.41
481 0.39
482 0.35
483 0.33
484 0.29
485 0.27
486 0.31
487 0.29
488 0.23
489 0.22
490 0.28
491 0.32