Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GGQ2

Protein Details
Accession A0A2T4GGQ2   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-40IPKTRNTYCKGKECRKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto_nucl 4, nucl 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MTRWLTLWIQQVNIPKTRNTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVKCKTKLQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.39
4 0.44
5 0.47
6 0.44
7 0.5
8 0.52
9 0.6
10 0.68
11 0.72
12 0.74
13 0.75
14 0.81
15 0.8
16 0.84
17 0.84
18 0.85
19 0.82
20 0.84
21 0.86
22 0.79
23 0.78
24 0.71
25 0.66
26 0.58
27 0.53
28 0.42
29 0.34
30 0.32
31 0.32
32 0.3
33 0.27
34 0.32
35 0.36
36 0.4
37 0.45
38 0.49
39 0.45
40 0.52
41 0.59
42 0.56
43 0.58
44 0.56
45 0.56
46 0.54
47 0.57
48 0.48
49 0.43
50 0.4
51 0.33
52 0.35
53 0.37
54 0.36
55 0.31
56 0.38
57 0.43
58 0.51
59 0.6
60 0.63
61 0.62
62 0.66
63 0.73
64 0.73
65 0.72
66 0.67
67 0.64
68 0.65
69 0.65
70 0.64
71 0.59
72 0.56
73 0.52
74 0.5
75 0.49
76 0.47
77 0.5
78 0.54
79 0.58
80 0.62
81 0.7
82 0.75
83 0.76
84 0.71
85 0.65
86 0.58
87 0.51
88 0.49
89 0.5
90 0.5
91 0.52
92 0.54
93 0.52
94 0.49
95 0.49
96 0.42