Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GEE6

Protein Details
Accession A0A2T4GEE6    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-43QLNPIACSHCRQRKRKVRRIEQPRKPGETLHydrophilic
NLS Segment(s)
PositionSequence
26-38RKRKVRRIEQPRK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MASNEAILEQESGQLNPIACSHCRQRKRKVRRIEQPRKPGETLTNKSLQCDRNMLVYIYCRLNRIVSYIHRPHCLQCNNDPSRCQYPEQNKRGLPIGFITRLEARLAETEEALFRLVQSIEEPEDNQVSLKPSSQRKDDRIREWDSLPLRTPEQVKSWYRNRLGQSDTPIVHDVSMDLDQQESSTHVISSGADGVEFPDGQSNSGAEIMLPDAGVEVDSTTEIHTSGVPVGSKAKDMEHRNPHLYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.18
5 0.17
6 0.17
7 0.22
8 0.31
9 0.39
10 0.48
11 0.56
12 0.65
13 0.72
14 0.82
15 0.87
16 0.88
17 0.89
18 0.9
19 0.93
20 0.93
21 0.93
22 0.92
23 0.91
24 0.86
25 0.76
26 0.69
27 0.67
28 0.66
29 0.61
30 0.56
31 0.56
32 0.49
33 0.51
34 0.54
35 0.47
36 0.4
37 0.39
38 0.34
39 0.31
40 0.32
41 0.3
42 0.24
43 0.24
44 0.24
45 0.24
46 0.24
47 0.21
48 0.2
49 0.21
50 0.2
51 0.2
52 0.22
53 0.21
54 0.3
55 0.36
56 0.39
57 0.4
58 0.41
59 0.42
60 0.46
61 0.46
62 0.41
63 0.41
64 0.48
65 0.5
66 0.52
67 0.5
68 0.46
69 0.49
70 0.47
71 0.42
72 0.39
73 0.45
74 0.53
75 0.56
76 0.57
77 0.51
78 0.5
79 0.53
80 0.45
81 0.35
82 0.27
83 0.25
84 0.2
85 0.2
86 0.2
87 0.16
88 0.17
89 0.16
90 0.13
91 0.1
92 0.1
93 0.11
94 0.1
95 0.09
96 0.08
97 0.08
98 0.08
99 0.08
100 0.06
101 0.05
102 0.06
103 0.06
104 0.05
105 0.06
106 0.06
107 0.07
108 0.07
109 0.08
110 0.07
111 0.08
112 0.08
113 0.07
114 0.07
115 0.08
116 0.09
117 0.1
118 0.15
119 0.21
120 0.24
121 0.31
122 0.36
123 0.4
124 0.5
125 0.55
126 0.56
127 0.57
128 0.59
129 0.54
130 0.5
131 0.49
132 0.41
133 0.36
134 0.31
135 0.27
136 0.23
137 0.23
138 0.24
139 0.2
140 0.22
141 0.27
142 0.29
143 0.34
144 0.4
145 0.45
146 0.46
147 0.5
148 0.49
149 0.47
150 0.48
151 0.44
152 0.43
153 0.41
154 0.38
155 0.35
156 0.33
157 0.28
158 0.23
159 0.2
160 0.14
161 0.11
162 0.11
163 0.09
164 0.08
165 0.08
166 0.08
167 0.08
168 0.08
169 0.07
170 0.08
171 0.08
172 0.08
173 0.07
174 0.08
175 0.08
176 0.09
177 0.09
178 0.08
179 0.07
180 0.07
181 0.08
182 0.09
183 0.09
184 0.08
185 0.12
186 0.12
187 0.13
188 0.14
189 0.13
190 0.13
191 0.13
192 0.13
193 0.07
194 0.07
195 0.07
196 0.07
197 0.06
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.04
204 0.04
205 0.05
206 0.06
207 0.06
208 0.07
209 0.07
210 0.07
211 0.07
212 0.08
213 0.09
214 0.12
215 0.11
216 0.12
217 0.17
218 0.18
219 0.2
220 0.2
221 0.23
222 0.29
223 0.36
224 0.45
225 0.51
226 0.57