Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4H7C5

Protein Details
Accession A0A2T4H7C5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-30EQRLFACERCSRRKQRCDRTIPVCQPCQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSEQRLFACERCSRRKQRCDRTIPVCQPCQEAQAECTGSASEGTVISGNDRIIARKGPVTRLLEQIEALEEKLRVMTEESLAVVTLLQRLSMIDCHKMLPQGHLSTRTRQLYHTPQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.84
4 0.88
5 0.9
6 0.9
7 0.89
8 0.86
9 0.86
10 0.84
11 0.8
12 0.73
13 0.64
14 0.59
15 0.5
16 0.46
17 0.37
18 0.29
19 0.23
20 0.23
21 0.23
22 0.18
23 0.18
24 0.14
25 0.12
26 0.11
27 0.1
28 0.06
29 0.05
30 0.05
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.11
42 0.14
43 0.15
44 0.15
45 0.21
46 0.24
47 0.25
48 0.28
49 0.28
50 0.25
51 0.24
52 0.21
53 0.17
54 0.13
55 0.11
56 0.08
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.08
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.07
70 0.06
71 0.05
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.08
78 0.12
79 0.14
80 0.15
81 0.16
82 0.17
83 0.19
84 0.24
85 0.24
86 0.24
87 0.28
88 0.3
89 0.34
90 0.4
91 0.41
92 0.43
93 0.51
94 0.52
95 0.47
96 0.45
97 0.5