Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2T4GGY7

Protein Details
Accession A0A2T4GGY7    Localization Confidence High Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
23-49DLQGRITGKKKNATKKTRKGVNDECAEHydrophilic
105-128AEQQQQPGKKRNRQKERMARRAAEHydrophilic
NLS Segment(s)
PositionSequence
27-41RITGKKKNATKKTRK
113-124KKRNRQKERMAR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.333, cyto 5, cyto_pero 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR003323  OTU_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF02338  OTU  
PROSITE View protein in PROSITE  
PS50802  OTU  
CDD cd22762  OTU_fungi_OTU2-like  
Amino Acid Sequences MDNPAPTETLEQIQTRHRRELKDLQGRITGKKKNATKKTRKGVNDECAEMERQLRDKQAAEIAALNPSESKNDDDNEDDAAPEVEDKSEDKLAEEAQKLSLSEPAEQQQQPGKKRNRQKERMARRAAEQEAEAQRAEEEASNMTNYRAKESEYMKTIFEKHDLVEQDIAPDGHCLFSAVADQLEQNDIPLSDGTTQEPAYKTVRRVASNYMLEHGDDFAPFLEEDLEGYARKMKDTAEWGGQLELMALARQYKAEIRVVQDGRMERIGEEEGAESGKTLWLAYYRHGYGLGEHYNSLRKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.5
4 0.53
5 0.53
6 0.6
7 0.68
8 0.69
9 0.71
10 0.69
11 0.63
12 0.65
13 0.63
14 0.62
15 0.6
16 0.57
17 0.52
18 0.58
19 0.63
20 0.66
21 0.74
22 0.78
23 0.8
24 0.84
25 0.88
26 0.88
27 0.85
28 0.84
29 0.83
30 0.81
31 0.74
32 0.66
33 0.57
34 0.5
35 0.46
36 0.37
37 0.31
38 0.25
39 0.24
40 0.25
41 0.26
42 0.27
43 0.27
44 0.28
45 0.29
46 0.26
47 0.23
48 0.23
49 0.2
50 0.2
51 0.19
52 0.16
53 0.13
54 0.13
55 0.14
56 0.13
57 0.16
58 0.16
59 0.17
60 0.19
61 0.2
62 0.21
63 0.22
64 0.2
65 0.16
66 0.14
67 0.13
68 0.11
69 0.09
70 0.08
71 0.06
72 0.06
73 0.07
74 0.1
75 0.12
76 0.12
77 0.12
78 0.13
79 0.15
80 0.19
81 0.2
82 0.18
83 0.16
84 0.17
85 0.17
86 0.16
87 0.17
88 0.13
89 0.13
90 0.15
91 0.16
92 0.21
93 0.21
94 0.22
95 0.25
96 0.3
97 0.34
98 0.42
99 0.49
100 0.52
101 0.61
102 0.7
103 0.75
104 0.78
105 0.83
106 0.84
107 0.86
108 0.88
109 0.84
110 0.75
111 0.68
112 0.65
113 0.56
114 0.46
115 0.35
116 0.31
117 0.26
118 0.26
119 0.22
120 0.16
121 0.14
122 0.13
123 0.14
124 0.08
125 0.06
126 0.06
127 0.06
128 0.07
129 0.07
130 0.08
131 0.1
132 0.1
133 0.12
134 0.12
135 0.13
136 0.17
137 0.19
138 0.22
139 0.22
140 0.23
141 0.21
142 0.22
143 0.23
144 0.19
145 0.18
146 0.16
147 0.13
148 0.16
149 0.16
150 0.16
151 0.16
152 0.15
153 0.13
154 0.13
155 0.13
156 0.09
157 0.08
158 0.07
159 0.06
160 0.06
161 0.06
162 0.05
163 0.05
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.07
178 0.07
179 0.08
180 0.09
181 0.1
182 0.1
183 0.12
184 0.13
185 0.15
186 0.18
187 0.2
188 0.21
189 0.26
190 0.31
191 0.3
192 0.32
193 0.35
194 0.39
195 0.39
196 0.38
197 0.33
198 0.29
199 0.27
200 0.25
201 0.2
202 0.13
203 0.09
204 0.09
205 0.07
206 0.08
207 0.07
208 0.07
209 0.07
210 0.06
211 0.06
212 0.08
213 0.09
214 0.07
215 0.08
216 0.13
217 0.13
218 0.14
219 0.14
220 0.13
221 0.17
222 0.22
223 0.25
224 0.24
225 0.25
226 0.25
227 0.25
228 0.24
229 0.19
230 0.15
231 0.11
232 0.07
233 0.06
234 0.06
235 0.07
236 0.07
237 0.07
238 0.09
239 0.11
240 0.14
241 0.2
242 0.22
243 0.25
244 0.34
245 0.35
246 0.36
247 0.37
248 0.36
249 0.34
250 0.34
251 0.3
252 0.21
253 0.23
254 0.22
255 0.17
256 0.16
257 0.13
258 0.11
259 0.12
260 0.12
261 0.09
262 0.08
263 0.09
264 0.09
265 0.08
266 0.08
267 0.12
268 0.14
269 0.17
270 0.24
271 0.23
272 0.24
273 0.25
274 0.24
275 0.23
276 0.29
277 0.3
278 0.24
279 0.25
280 0.26
281 0.32