Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GXE0

Protein Details
Accession A0A2T4GXE0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-114FNGIKRVDPKKPLRRCQDWERETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 15.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR046670  DUF6540  
Pfam View protein in Pfam  
PF20174  DUF6540  
Amino Acid Sequences MSYLSVYLLDYLGVPLNHHSIFVKDAKDETEFVFYVIGNIQMGCIFEVRRQESDPRLSATFKKMTQIGVIAANDTPRFRTVCESNPPPKKQFNGIKRVDPKKPLRRCQDWERETIDILREQGVLLNAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.16
4 0.15
5 0.16
6 0.16
7 0.14
8 0.18
9 0.2
10 0.2
11 0.17
12 0.18
13 0.2
14 0.21
15 0.21
16 0.18
17 0.19
18 0.17
19 0.16
20 0.16
21 0.13
22 0.12
23 0.11
24 0.1
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.08
34 0.14
35 0.16
36 0.17
37 0.19
38 0.22
39 0.26
40 0.3
41 0.29
42 0.27
43 0.26
44 0.26
45 0.26
46 0.27
47 0.27
48 0.23
49 0.23
50 0.21
51 0.2
52 0.19
53 0.17
54 0.13
55 0.12
56 0.11
57 0.1
58 0.09
59 0.1
60 0.1
61 0.09
62 0.1
63 0.09
64 0.1
65 0.1
66 0.15
67 0.17
68 0.22
69 0.3
70 0.36
71 0.44
72 0.52
73 0.56
74 0.56
75 0.57
76 0.54
77 0.56
78 0.59
79 0.58
80 0.59
81 0.59
82 0.64
83 0.69
84 0.73
85 0.7
86 0.69
87 0.71
88 0.72
89 0.78
90 0.78
91 0.78
92 0.8
93 0.82
94 0.83
95 0.84
96 0.77
97 0.72
98 0.67
99 0.59
100 0.52
101 0.47
102 0.39
103 0.3
104 0.27
105 0.23
106 0.18
107 0.17
108 0.17