Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2T4GG00

Protein Details
Accession A0A2T4GG00    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-69SEPQLRPTKGMKKNKKTKPFARRVQTRPHydrophilic
NLS Segment(s)
PositionSequence
49-64TKGMKKNKKTKPFARR
Subcellular Location(s) nucl 8cysk 8, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MASVSFVNVIPTETGSDRSPGSVNTASVMTYVLQQVPIDAASEPQLRPTKGMKKNKKTKPFARRVQTRPMVPRCASKIASSVSRDVTETWAELMSFTETPLGYSPDTEACKDLKTFDYYIRRSGAGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.17
4 0.16
5 0.17
6 0.17
7 0.15
8 0.2
9 0.19
10 0.18
11 0.17
12 0.17
13 0.15
14 0.14
15 0.15
16 0.09
17 0.08
18 0.09
19 0.08
20 0.09
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.06
27 0.06
28 0.09
29 0.12
30 0.12
31 0.17
32 0.21
33 0.2
34 0.23
35 0.29
36 0.36
37 0.43
38 0.54
39 0.58
40 0.65
41 0.75
42 0.82
43 0.86
44 0.85
45 0.86
46 0.86
47 0.85
48 0.83
49 0.83
50 0.82
51 0.76
52 0.77
53 0.72
54 0.66
55 0.64
56 0.6
57 0.56
58 0.48
59 0.48
60 0.42
61 0.42
62 0.38
63 0.3
64 0.29
65 0.26
66 0.29
67 0.26
68 0.25
69 0.22
70 0.21
71 0.21
72 0.18
73 0.19
74 0.15
75 0.13
76 0.12
77 0.11
78 0.1
79 0.09
80 0.1
81 0.1
82 0.09
83 0.09
84 0.1
85 0.09
86 0.11
87 0.12
88 0.13
89 0.11
90 0.11
91 0.13
92 0.16
93 0.19
94 0.19
95 0.2
96 0.18
97 0.21
98 0.21
99 0.22
100 0.21
101 0.23
102 0.24
103 0.31
104 0.39
105 0.39
106 0.44
107 0.43